Property Summary

NCBI Gene PubMed Count 32
Grant Count 125
R01 Count 65
Funding $31,610,130.97
PubMed Score 1722.65
PubTator Score 51.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.055 0.019
astrocytic glioma -1.300 0.026
ependymoma -1.400 0.046
osteosarcoma -1.064 0.000
glioblastoma -1.500 0.013
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
lung cancer 1.300 0.000
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -1.477 0.019
Pick disease -1.500 0.007
invasive ductal carcinoma 1.100 0.010
ovarian cancer 1.700 0.000

Synonym

Accession O94972 A8K0V9 A8K8U4 A8MZ79 B4DGZ3 F8WEE6 Q7Z3E6 Q8IYF7 Q8WYF7
Symbols MUL
POB1
TEF3

Gene

PANTHER Protein Class (2)

PDB

3LRQ  

Gene RIF (12)

PMID Text
26208456 These finding may provide insight into the understanding of TRIM37 as a novel critical factor of HCC and a candidate target for HCC treatment.
25470042 results reveal TRIM37 as an oncogenic H2A ubiquitin ligase that is overexpressed in a subset of breast cancers and promotes transformation by facilitating silencing of tumour suppressors and other genes.
24317724 In this study, authors demonstrate that human Trim 37 possesses anti-HIV-1 activity.
23385855 Our report underlines the necessity of early clinical diagnosis of Mulibrey nanism. Careful cardiologic examination is required to detect constrictive pericarditis, which is a major factor of mortality in these patients
19329943 inherited biallelic inactivation of TRIM37 (Mulibrey nanism) predisposes to both mesenchymal and epithelial ovarian tumors and dysregulation of TRIM37 may also be involved in the pathogenesis of sporadic fibrothecomas.
17551331 Mutation screening of the TRIM37 gene revealed that the proband had a homozygous two base pair deletion, c.1894_1895delGA, resulting in a frame-shift and a premature termination codon.
17100991 Novel mutations in the tumor necrosis factor receptor associated factor (TRAF) domain alter the subcellular localization of TRIM37, and are associated with Wilm's tumor in a patient with mulibrey nanism.
16310976 TRIM37 expression is regulated by several mechanisms: through nonsense surveillance of non-functional transcripts, as well as through 3'UTR regulatory sequences and/or naturally occurring antisense RNAs especially in testis.
16306379 Functional link of TRIM37 to the ubiquitin-proteosome pathway may provide novel clues to the development of metabolic syndrome.
15885686 The TRIM37 acts as a TRIM domain-dependent E3 ubiquitin ligase and imply defective ubiquitin-dependent degradation of an as-yet-unidentified target protein in the pathogenesis of mulibrey nanism.
More...

AA Sequence

MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAE      1 - 70
EVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGGMHGGHTFKPLAEIYEQHV     71 - 140
TKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVREIRNAVEMMIARLDTQLKNKLITLMGQKTS    141 - 210
LTQETELLESLLQEVEHQLRSCSKSELISKSSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSAT    211 - 280
FVLENFSTLRQRADPVYSPPLQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQ    281 - 350
SCNDPTKNIIREFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT    351 - 420
QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDMLLEGGPTTAS    421 - 490
VREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASSTATSNTEENDIDEETMSGEN    491 - 560
DVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRRTHLCSAATSSLLDIDPLILIHLLDLKDRSS    561 - 630
IENLWGLQPRPPASLLQPTASYSRKDKDQRKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIK    631 - 700
SSSAASGDMQTSLFSADQAALAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAG    701 - 770
SLSLRRAVDPGENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV    771 - 840
AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDT    841 - 910
ENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR                    911 - 964
//

Text Mined References (38)

PMID Year Title
26697951 2016 FTO variant associated with malformation syndrome.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26208456 2015 Over-expression of TRIM37 promotes cell migration and metastasis in hepatocellular carcinoma by activating Wnt/?-catenin signaling.
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
25416956 2014 A proteome-scale map of the human interactome network.
24317724 2014 Anti-HIV-1 activity of Trim 37.
23769972 2013 Discovering regulators of centriole biogenesis through siRNA-based functional genomics in human cells.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23385855 2013 Refractory congestive heart failure following delayed pericardectomy in a 12-year-old child with Mulibrey nanism due to a novel mutation in TRIM37.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...