Property Summary

NCBI Gene PubMed Count 38
PubMed Score 1754.81
PubTator Score 51.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.343 1.7
Disease Target Count
Mulibrey nanism syndrome 1

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-04
astrocytic glioma -1.300 2.6e-02
Astrocytoma, Pilocytic -1.300 1.9e-09
atypical teratoid / rhabdoid tumor -1.200 2.1e-06
ependymoma -1.400 4.6e-02
glioblastoma -1.500 1.3e-02
invasive ductal carcinoma 1.100 9.8e-03
lung cancer 1.300 3.7e-04
medulloblastoma, large-cell -1.300 1.1e-04
Multiple myeloma 1.055 1.9e-02
osteosarcoma -1.064 6.6e-05
ovarian cancer 1.700 1.1e-04
Pick disease -1.500 6.7e-03
subependymal giant cell astrocytoma -1.477 1.9e-02

 OMIM Phenotype (1)

Gene RIF (16)

AA Sequence

MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAE      1 - 70
EVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGGMHGGHTFKPLAEIYEQHV     71 - 140
TKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVREIRNAVEMMIARLDTQLKNKLITLMGQKTS    141 - 210
LTQETELLESLLQEVEHQLRSCSKSELISKSSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSAT    211 - 280
FVLENFSTLRQRADPVYSPPLQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQ    281 - 350
SCNDPTKNIIREFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT    351 - 420
QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDMLLEGGPTTAS    421 - 490
VREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASSTATSNTEENDIDEETMSGEN    491 - 560
DVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRRTHLCSAATSSLLDIDPLILIHLLDLKDRSS    561 - 630
IENLWGLQPRPPASLLQPTASYSRKDKDQRKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIK    631 - 700
SSSAASGDMQTSLFSADQAALAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAG    701 - 770
SLSLRRAVDPGENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV    771 - 840
AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDT    841 - 910
ENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR                    911 - 964
//

Text Mined References (44)

PMID Year Title