Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.73
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.600 5.0e-04
astrocytic glioma -1.500 2.0e-02
Astrocytoma, Pilocytic -1.600 4.5e-07
atypical teratoid / rhabdoid tumor -2.400 3.7e-05
ependymoma -1.600 9.1e-03
glioblastoma -1.400 2.0e-05
limb girdle muscular dystrophy 2B -1.013 3.0e-04
malignant mesothelioma -2.100 1.1e-07
medulloblastoma, large-cell -2.200 3.7e-05
oligodendroglioma -1.700 1.9e-02
ovarian cancer -1.400 4.0e-06
pituitary cancer 1.300 5.9e-05

AA Sequence

MTAEETVNVKEVEIIKLILDFLNSKKLHISMLALEKESGVINGLFSDDMLFLRQLILDGQWDEVLQFIQP      1 - 70
LECMEKFDKKRFRYIILKQKFLEALCVNNAMSAEDEPQHLEFTMQEAVQCLHALEEYCPSKDDYSKLCLL     71 - 140
LTLPRLTNHAEFKDWNPSTARVHCFEEACVMVAEFIPADRKLSEAGFKASNNRLFQLVMKGLLYECCVEF    141 - 210
CQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAY    211 - 280
ADLLTPLISKLSPYPSSPMRRPQSADAYMTRSLNPALDGLTCGLTSHDKRISDLGNKTSPMSHSFANFHY    281 - 350
PGVQNLSRSLMLENTECHSIYEESPERDTPVDAQRPIGSEILGQSSVSEKEPANGAQNPGPAKQEKNELR    351 - 420
DSTEQFQEYYRQRLRYQQHLEQKEQQRQIYQQMLLEGGVNQEDGPDQQQNLTEQFLNRSIQKLGELNIGM    421 - 490
DGLGNEVSALNQQCNGSKGNGSNGSSVTSFTTPPQDSSQRLTHDASNIHTSTPRNPGSTNHIPFLEESPC    491 - 560
GSQISSEHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTL    561 - 630
RVCAYPDVIDPSAHETPKQPVVRFKRNKHHKGSIYCVAWSPCGQLLATGSNDKYVKVLPFNAETCNATGP    631 - 700
DLEFSMHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQRGQGLHALSGHTGHILALYTWSGWMIA    701 - 770
SGSQDKTVRFWDLRVPSCVRVVGTTFHGTGSAVASVAVDPSGRLLATGQEDSSCMLYDIRGGRMVQSYHP    771 - 840
HSSDVRSVRFSPGAHYLLTGSYDMKIKVTDLQGDLTKQLPIMVVGEHKDKVIQCRWHTQDLSFLSSSADR    841 - 910
TVTLWTYNG                                                                 911 - 919
//

Text Mined References (14)

PMID Year Title