Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $729,117.5
PubMed Score 20.45
PubTator Score 10.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.009
osteosarcoma -1.328 0.000

Gene

 Grant Application (2)

PDB

1WH0   4X3G  

Gene RIF (10)

PMID Text
26988033 USP19 positively regulates autophagy and antiviral immune responses by deubiquitinating Beclin-1.
26808260 In conjunction with HSP90, the cytoplasmic USP19 may play a key role in triage decision for the disease-related polyQ-expanded substrates, suggesting a function of USP19 in quality control of misfolded proteins by regulating their protein levels
26048142 Expression of USP19 correlates with that of MuRF1 and MAFbx/atrogin-1 in skeletal muscles
24356957 These results clarify the role of USP19 in ERAD and suggest a novel DUB regulation that involves chaperone association and membrane integration
23500468 USP19 interacts with the ubiquitin ligases SIAH1 and SIAH2, which promote USP19 ubiquitylation and degradation by the proteasome.
22810585 experimentally verified the targets heterogeneous nuclear ribonucleoprotein U, phosphatidylinositol-3-OH kinase, the WNK (with-no-lysine) kinase family and USP19 (ubiquitin-specific peptidase 19) as vulnerable nodes in the host cellular defence system against viruses
22128162 ubiquitin-specific protease-19 (USP19) interacts with components of the hypoxia pathway including HIF-1alpha and rescues it from degradation independent of its catalytic activity
21849505 The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.
21264218 ability of USP19 to regulate cell proliferation and p27(Kip1) levels; complete loss of USP19 function on cell growth may arise as a result of oncogenic transformation of cells.
19465887 USP19 is the first example of a membrane-anchored deubiquitinating enzymes involved in the turnover of endoplasmic-reticulum-associated degradation substrates.

AA Sequence

MSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGDPRKETGSRYVAQAGLEPLASGDPSASASHAAG      1 - 70
ITGSRHRTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPTPELLLDWRQSAEEVIVKLRVGVGPLQL     71 - 140
EDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTRKGSLLHLTLPKKVPMLTWPSLLVEADEQLC    141 - 210
IPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMV    211 - 280
NLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKL    281 - 350
RNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQE    351 - 420
EARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKK    421 - 490
VCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKG    491 - 560
THHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEA    561 - 630
WQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFL    631 - 700
VSVSKENSTASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLLCFELLSSELAKE    701 - 770
RVVVLEVQQRPQVPSVPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGY    771 - 840
PFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTGSLEAGDSERDPIQP    841 - 910
PELQLVTPMAEGDTGLPRVWAAPDRGPVPSTSGISSEMLASGPIEVGSLPAGERVSRPEAAVPGYQHPSE    911 - 980
AMNAHTPQFFIYKIDSSNREQRLEDKGDTPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAG    981 - 1050
EAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDK   1051 - 1120
INDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDD   1121 - 1190
STVTTVDESQVVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAEAAASQASRIWQELEAEEEPVPE   1191 - 1260
GSGPLGPWGPQDWVGPLPRGPTTPDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR               1261 - 1318
//

Text Mined References (23)

PMID Year Title
26988033 2016 USP19 modulates autophagy and antiviral immune responses by deubiquitinating Beclin-1.
26808260 2016 Cytoplasmic Ubiquitin-Specific Protease 19 (USP19) Modulates Aggregation of Polyglutamine-Expanded Ataxin-3 and Huntingtin through the HSP90 Chaperone.
26048142 2015 Inactivation of the ubiquitin-specific protease 19 deubiquitinating enzyme protects against muscle wasting.
25088257 2014 Ubiquitin-specific protease 19 regulates the stability of the E3 ubiquitin ligase MARCH6.
24356957 2014 Characterization of the deubiquitinating activity of USP19 and its role in endoplasmic reticulum-associated degradation.
23500468 2013 An N-terminal SIAH-interacting motif regulates the stability of the ubiquitin specific protease (USP)-19.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22810585 2012 Viral immune modulators perturb the human molecular network by common and unique strategies.
22689415 2012 Profiling ubiquitin linkage specificities of deubiquitinating enzymes with branched ubiquitin isopeptide probes.
22128162 2012 Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1? (HIF-1?) during hypoxia.
More...