Property Summary

NCBI Gene PubMed Count 48
PubMed Score 109.56
PubTator Score 106.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94956 A8K2G9 B4DGA9 B4DTB0 E7ERN5 E9PPU8 Q9H2Z0 Q9UFU1
Symbols OATPB
OATP-B
OATP2B1
SLC21A9

Gene

PANTHER Protein Class (1)

 IMPC Term (1)

Gene RIF (44)

PMID Text
26668348 The association of SNP rs1077858 with OS may be a result of differential SLCO2B1 expression and the consequent increased uptake of DHEAS and subsequent resistance to ADT, which, in turn, may contribute to decreased OS.
26526067 OATP2B1 contributes to the uptake of SN-38 by intestinal tissues, triggering gastrointestinal toxicity.
26409184 Results identified interethnic differences of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes in Korean population compared with other ethnic groups.
26091578 OATP2B1 as a determinant of pharmacokinetics in the coronary artery.
25857231 Suggest that OATP2B1 is involved in cell proliferation by increasing the amount of estrogen in ER1-positive breast cancer cells.
24903351 These results suggest that OATP2B1 plays an important role in the stereoselective pharmacokinetics of fexofenadine and that one-time apple juice ingestion probably inhibits intestinal OATP2B1-mediated transport of both enantiomers
24762081 The genotypes of the two other SLCOs,SLCO1B3 and SLCO2B1, did not show any association with bladder cancer susceptibility
23970434 SLCO2B1 polymorphisms do not affect the pharmacokinetics of montelukast and SLCO2B1 polymorphisms appear to be a minor determinant of inter-individual variability of montelukast.
23896625 SLCO2B1 rs12422149 variants could provide prognostic value for prostate cancer patients treated with androgen deprivation therapy (ADT) and influence ethnic differences in response to ADT.
23531488 the major OATP2B1 protein form in liver is transport competent and its hepatic expression is regulated by HNF4alpha.
More...

AA Sequence

MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLK      1 - 70
SSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISE     71 - 140
PYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFG    141 - 210
ISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGF    211 - 280
LIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPN    281 - 350
LTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS    351 - 420
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCM    421 - 490
EACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHL    491 - 560
VVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWA    561 - 630
LSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGP    631 - 700
GKKPEDSRV                                                                 701 - 709
//

Text Mined References (53)

PMID Year Title
26668348 2016 Association of SLCO2B1 Genotypes With Time to Progression and Overall Survival in Patients Receiving Androgen-Deprivation Therapy for Prostate Cancer.
26526067 2016 Organic Anion Transporting Polypeptide (OATP)2B1 Contributes to Gastrointestinal Toxicity of Anticancer Drug SN-38, Active Metabolite of Irinotecan Hydrochloride.
26409184 2015 Comparison of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes among five ethnic groups.
26091578 2015 Expression of OATP2B1 as determinant of drug effects in the microcompartment of the coronary artery.
25857231 2015 Organic anion transporting polypeptide 2B1 expression correlates with uptake of estrone-3-sulfate and cell proliferation in estrogen receptor-positive breast cancer cells.
24903351 2014 Effects of one-time apple juice ingestion on the pharmacokinetics of fexofenadine enantiomers.
24762081 2014 SLCO1B1, SLCO2B1, and SLCO1B3 polymorphisms and susceptibility to bladder cancer risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23970434 2013 Effects of polymorphisms of the SLCO2B1 transporter gene on the pharmacokinetics of montelukast in humans.
23896625 2013 Polymorphisms of the androgen transporting gene SLCO2B1 may influence the castration resistance of prostate cancer and the racial differences in response to androgen deprivation.
More...