Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.08
PubTator Score 6.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.41710986666772E-11
osteosarcoma 7933 1.48988314612718E-10
juvenile dermatomyositis 1189 3.17733210067893E-9
acute quadriplegic myopathy 1157 3.69099425291544E-7
Pick disease 1893 1.6074282955681E-6
posterior fossa group A ependymoma 1511 1.65204071384424E-6
ovarian cancer 8492 8.79405739752729E-6
malignant mesothelioma 3163 3.34125500133337E-5
Atopic dermatitis 944 2.37696325471487E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.89413163239399E-4
pediatric high grade glioma 2712 5.39878403032449E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.20615407346569E-4
cutaneous lupus erythematosus 1056 7.3091307562192E-4
glioblastoma 5572 0.00106769783539252
interstitial cystitis 2299 0.0014288211154143
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00225517796081297
group 4 medulloblastoma 1875 0.0026875883770814
tuberculosis and treatment for 6 months 686 0.00319460648610938
medulloblastoma, large-cell 6234 0.00598582061003167
lung cancer 4473 0.0114045780216107
Down syndrome 548 0.0115180274406002
atypical teratoid / rhabdoid tumor 4369 0.0163087066177651
Breast cancer 3099 0.0265767840127148
ductal carcinoma in situ 1745 0.0279803283661171
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0291176876392639
interstitial lung disease 292 0.0314472002063904
aldosterone-producing adenoma 664 0.0323001600546486
colon cancer 1475 0.0404733997691826
nasopharyngeal carcinoma 1056 0.0482603078998183
adrenocortical carcinoma 1427 0.0499524793448257

Expression

Synonym

Accession O94955 A0PJA4 A8K1W9 Q8IW06
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (5)

PMID Text
26215701 RHOBTB3 serves as a scaffold to organize a multi-subunit complex that promotes the hydroxylation, ubiquitination and degradation of HIFalpha.
24145166 Reveal a novel role for a RhoBTB3 in catalyzing cyclin E turnover during S phase, as well as an unexpected, essential role for the Golgi as a ubiquitylation platform for cell cycle control.
22245496 The interaction between RhoBTB3 and the 5-HT7a receptor strongly inhibits proteasomal degradation of the 5-HT7a receptor.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19490898 Study reports that the atypical Rho GTPase family member, RhoBTB3, binds directly to Rab9 GTPase and functions with Rab9 in protein transport from endosomes to the trans Golgi network.

AA Sequence

MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVV      1 - 70
HDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKRALNSVPVIIAAVGTRQNEE     71 - 140
LPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKR    141 - 210
KMSNSFHGIRPPQLEQPEKMPVLKAEASHYNSDLNNLLFCCQCVDVVFYNPNLKKVVEAHKIVLCAVSHV    211 - 280
FMLLFNVKSPTDIQDSSIIRTTQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSG    281 - 350
AFQWEELEEDIRKKLKDSGDVSNVIEKVKCILKTPGKINCLRNCKTYQARKPLWFYNTSLKFFLNKPMLA    351 - 420
DVVFEIQGTTVPAHRAILVARCEVMAAMFNGNYMEAKSVLIPVYGVSKETFLSFLEYLYTDSCCPAGIFQ    421 - 490
AMCLLICAEMYQVSRLQHICELFIITQLQSMPSRELASMNLDIVDLLKKAKFHHSDCLSTWLLHFIATNY    491 - 560
LIFSQKPEFQDLSVEERSFVEKHRWPSNMYLKQLAEYRKYIHSRKCRCLVM                       561 - 611
//

Text Mined References (18)

PMID Year Title
26215701 2015 RHOBTB3 promotes proteasomal degradation of HIF? through facilitating hydroxylation and suppresses the Warburg effect.
25416956 2014 A proteome-scale map of the human interactome network.
24145166 2013 Golgi-associated RhoBTB3 targets cyclin E for ubiquitylation and promotes cell cycle progression.
22245496 2012 RhoBTB3 interacts with the 5-HT7a receptor and inhibits its proteasomal degradation.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19490898 2009 RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17035353 2007 Evolution of the Rho family of ras-like GTPases in eukaryotes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...