Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.08
PubTator Score 6.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.559 3.7e-07
adrenocortical carcinoma 1.136 5.0e-02
aldosterone-producing adenoma -1.660 3.2e-02
Atopic dermatitis -1.100 9.2e-04
atypical teratoid / rhabdoid tumor -1.800 1.6e-02
Breast cancer 3.000 2.7e-02
colon cancer 1.500 4.0e-02
cutaneous lupus erythematosus -1.300 7.3e-04
Down syndrome 1.500 1.2e-02
ductal carcinoma in situ -1.200 2.8e-02
ependymoma 1.400 4.1e-03
glioblastoma 1.300 1.1e-03
group 4 medulloblastoma -1.500 2.7e-03
interstitial cystitis -1.400 1.3e-03
interstitial lung disease -1.100 3.1e-02
intraductal papillary-mucinous adenoma (... -3.800 6.9e-04
intraductal papillary-mucinous carcinoma... -2.100 3.8e-02
intraductal papillary-mucinous neoplasm ... -3.800 6.2e-04
juvenile dermatomyositis 1.089 3.2e-09
lung cancer 1.100 8.7e-03
malignant mesothelioma 1.600 3.3e-05
medulloblastoma, large-cell 1.400 6.0e-03
nasopharyngeal carcinoma 1.200 4.8e-02
osteosarcoma 3.926 1.5e-10
ovarian cancer -1.400 2.0e-05
pancreatic ductal adenocarcinoma liver m... -2.066 2.3e-03
pediatric high grade glioma 1.300 5.4e-04
Pick disease 2.200 1.6e-06
psoriasis -1.400 3.2e-04
tuberculosis and treatment for 6 months 1.300 3.2e-03

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVV      1 - 70
HDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKRALNSVPVIIAAVGTRQNEE     71 - 140
LPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKR    141 - 210
KMSNSFHGIRPPQLEQPEKMPVLKAEASHYNSDLNNLLFCCQCVDVVFYNPNLKKVVEAHKIVLCAVSHV    211 - 280
FMLLFNVKSPTDIQDSSIIRTTQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSG    281 - 350
AFQWEELEEDIRKKLKDSGDVSNVIEKVKCILKTPGKINCLRNCKTYQARKPLWFYNTSLKFFLNKPMLA    351 - 420
DVVFEIQGTTVPAHRAILVARCEVMAAMFNGNYMEAKSVLIPVYGVSKETFLSFLEYLYTDSCCPAGIFQ    421 - 490
AMCLLICAEMYQVSRLQHICELFIITQLQSMPSRELASMNLDIVDLLKKAKFHHSDCLSTWLLHFIATNY    491 - 560
LIFSQKPEFQDLSVEERSFVEKHRWPSNMYLKQLAEYRKYIHSRKCRCLVM                       561 - 611
//

Text Mined References (18)

PMID Year Title