Property Summary

NCBI Gene PubMed Count 37
Grant Count 10
R01 Count 3
Funding $787,558.66
PubMed Score 36.72
PubTator Score 28.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma 1.100 0.003
Rheumatoid Arthritis 2.200 0.003
oligodendroglioma 1.300 0.021
psoriasis 1.700 0.000
osteosarcoma -1.835 0.000
astrocytoma 1.700 0.009
tuberculosis and treatment for 6 months -1.400 0.001
Alzheimer's disease 1.100 0.016
Pick disease 1.600 0.000
progressive supranuclear palsy 1.100 0.033
ovarian cancer 2.200 0.000
pituitary cancer -1.100 0.001

Gene RIF (24)

PMID Text
26397136 High KDM4B expression is associated with endometrial cancer progression.
25925418 Functional studies demonstrated that KDM4B regulates the Myc pathway. N-Myc was found to physically interact with and recruit KDM4B. KDM4B was found to regulate neuroblastoma cell proliferation and differentiation in vitro and xenograft growth in vivo.
25725194 Data indicate that miR-491-5p plays a tumor suppressor role in the development and progression of breast cancer via direct targeting the 3'UTR of JMJD2B mRNA.
25636512 JMJD2B and JMJD2C play an important role in the pathology of osteosarcoma via the up-regulation of FGF2.
25533242 results reveal that JMJD2B is dramatically upregulated in hepatocellular carcinoma, making it a potential diagnostic marker for the further development of HCC treatment therapies
24957706 Silencing of JMJD2B induces cell apoptosis via mitochondria-mediated and death receptor-mediated pathway activation in colorectal cancer.
24481461 KDM4B was upregulated in colon and rectal adenocarcinomas and required for efficient growth and clonogenic activity of human HT-29 colon cancer cells.
24473398 Jumonji domain-containing protein 2B has an essential role in cancer cell survival and tumor growth via DNA damage response mediation, which STAT3 partially regulates.
24077348 A novel function of JMJD2B in promoting epithelial-mesenchymal transition and gastric cancer invasion and metastasis.
23589305 novel pathway by which Hsp90 activity alters the histone code via regulation of KDM4B stability.
23376847 Results suggest that by regulating JMJD2b and SUV39H1 expression, p53 not only controls transcription but also promotes HC relaxation to accelerate a rate-limiting step in the repair of complex genomes.
23046878 JMJD2B may play a central role in gastric cancer cell growth and might constitute a novel therapeutic target to overcome hypoxia-induced radio-resistance, thereby improving the efficiency of radiation therapy.
22770241 The histone demethylases KDM4B and KDM6B play critical roles in osteogenic commitment of mesenchymal stem/stromal cells.
22745382 showed that JMJD2B was overexpressed in colorectal cancer tissues and positively correlated with expression of the hypoxic marker carbonic anhydrase 9
22133676 JMJD2B is required for sustained proliferation and survival of tumor cells in vitro and in vivo, and its aberrant expression may contribute to the pathogenesis of gastric cancer.
21930796 High JMJD2B is associated with bladder and lung carcinogenesis through positive regulation of cyclin-dependent kinase 6.
21502505 Histone demethylase JMJD2B coordinates H3K4/H3K9 methylation and promotes hormonally responsive breast carcinogenesis.
21445275 knockdown of JMJD2B severely impairs estrogen-induced cell proliferation and the tumor formation capacity of breast cancer cells
21445275 JMJD2B interacts with ERalpha and components of the SWI/SNF-B chromatin remodeling complex. JMJD2B is recruited to ERalpha target sites, demethylates H3K9me3 and facilitates transcription of ER responsive genes including MYB, MYC and CCND1.
20682797 Histone demethylase JMJD2B is regulated by both ERalpha and HIF-1alpha, drives breast cancer cell proliferation in normoxia and hypoxia, and epigenetically regulates the expression of cell cycle genes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18984585 histone demethylases JMJD1A and JMJD2B are transcriptional targets of hypoxia-inducible factor HIF
18713068 Results show that many genes regulated by hypoxia and HIF-1alpha show patterns of induction with JMJD (Jumonji-domain containing)1A and JMJD2B demonstrating robust, and JMJD2C more modest, up-regulation by hypoxia.
17611647 Two GATA-binding sites within intron 6 of human JMJD2B gene were conserved in mouse Jmjd2b gene.

AA Sequence

MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTYDDIDDVVIPA      1 - 70
PIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGS     71 - 140
LYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWY    141 - 210
AIPPEHGKRLERLAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGF    211 - 280
NHGFNCAESTNFATLRWIDYGKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTAL    281 - 350
TSPELSSWSASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE    351 - 420
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALWLPSPLEPPVL    421 - 490
GPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAFNQEHVSCQQAFEHFAQKGPT    491 - 560
WKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTFSKLKMEIKKSRRHPLGRPPTRSPLSVVKQE    561 - 630
ASSDEEASPFSGEEDVSDPDALRPLLSLQWKNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTE    631 - 700
KEAPIASLGKGCPATLPSKSRQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHAS    701 - 770
CYGIRPELVNEGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI    771 - 840
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVSITCLKHKSGG    841 - 910
HAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEG    911 - 980
ELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGAPQEPAF    981 - 1050
SGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQGRPGAPF                           1051 - 1096
//

Text Mined References (42)

PMID Year Title
26397136 2015 KDM4B and KDM4A promote endometrial cancer progression by regulating androgen receptor, c-myc, and p27kip1.
25925418 2015 The role of histone demethylase KDM4B in Myc signaling in neuroblastoma.
25725194 2015 miR-491-5p functions as a tumor suppressor by targeting JMJD2B in ER?-positive breast cancer.
25636512 2015 Histone demethylase JMJD2B and JMJD2C induce fibroblast growth factor 2: mediated tumorigenesis of osteosarcoma.
25533242 2015 JMJD2B as a potential diagnostic immunohistochemical marker for hepatocellular carcinoma: a tissue microarray-based study.
24957706 2014 Silencing of JMJD2B induces cell apoptosis via mitochondria-mediated and death receptor-mediated pathway activation in colorectal cancer.
24481461 2014 Stimulation of ?-catenin and colon cancer cell growth by the KDM4B histone demethylase.
24473398 2014 Jumonji domain-containing protein 2B silencing induces DNA damage response via STAT3 pathway in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24077348 2013 JMJD2B promotes epithelial-mesenchymal transition by cooperating with ?-catenin and enhances gastric cancer metastasis.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23589305 2013 Heat shock protein 90 (Hsp90) selectively regulates the stability of KDM4B/JMJD2B histone demethylase.
23376847 2014 p53 promotes repair of heterochromatin DNA by regulating JMJD2b and SUV39H1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23046878 Histone demethylase JMJD2B-mediated cell proliferation regulated by hypoxia and radiation in gastric cancer cell.
22770241 2012 Histone demethylases KDM4B and KDM6B promotes osteogenic differentiation of human MSCs.
22745382 2012 HIF-1?-induced histone demethylase JMJD2B contributes to the malignant phenotype of colorectal cancer cells via an epigenetic mechanism.
22133676 2011 Histone demethylase JMJD2B is required for tumor cell proliferation and survival and is overexpressed in gastric cancer.
21930796 2011 The histone demethylase JMJD2B plays an essential role in human carcinogenesis through positive regulation of cyclin-dependent kinase 6.
21502505 2011 Histone demethylase JMJD2B coordinates H3K4/H3K9 methylation and promotes hormonally responsive breast carcinogenesis.
21445275 2011 Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.
20682797 2010 The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18984585 2008 The histone demethylases JMJD1A and JMJD2B are transcriptional targets of hypoxia-inducible factor HIF.
18713068 2008 Regulation of Jumonji-domain-containing histone demethylases by hypoxia-inducible factor (HIF)-1alpha.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17611647 2007 Comparative integromics on JMJD2A, JMJD2B and JMJD2C: preferential expression of JMJD2C in undifferentiated ES cells.
16603238 2006 Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15927959 2005 Functional characterization of JMJD2A, a histone deacetylase- and retinoblastoma-binding protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15138608 2004 Identification and characterization of JMJD2 family genes in silico.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.