Property Summary

Ligand Count 35
NCBI Gene PubMed Count 46
PubMed Score 40.58
PubTator Score 28.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
medulloblastoma 720 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.278 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
Alzheimer's disease 1.100 1.6e-02
astrocytoma 1.700 8.8e-03
group 4 medulloblastoma 1.100 5.8e-03
oligodendroglioma 1.300 2.1e-02
osteosarcoma 1.606 5.6e-04
ovarian cancer 2.200 2.2e-08
Pick disease 1.600 7.2e-07
pituitary cancer -1.100 8.7e-04
progressive supranuclear palsy 1.100 3.3e-02
psoriasis -1.100 1.4e-10
Rheumatoid arthritis 2.200 3.0e-03
tuberculosis and treatment for 3 months -1.100 1.2e-04

Protein-protein Interaction (11)

Gene RIF (31)

AA Sequence

MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTYDDIDDVVIPA      1 - 70
PIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGS     71 - 140
LYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWY    141 - 210
AIPPEHGKRLERLAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGF    211 - 280
NHGFNCAESTNFATLRWIDYGKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTAL    281 - 350
TSPELSSWSASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE    351 - 420
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALWLPSPLEPPVL    421 - 490
GPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAFNQEHVSCQQAFEHFAQKGPT    491 - 560
WKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTFSKLKMEIKKSRRHPLGRPPTRSPLSVVKQE    561 - 630
ASSDEEASPFSGEEDVSDPDALRPLLSLQWKNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTE    631 - 700
KEAPIASLGKGCPATLPSKSRQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHAS    701 - 770
CYGIRPELVNEGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI    771 - 840
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVSITCLKHKSGG    841 - 910
HAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEG    911 - 980
ELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGAPQEPAF    981 - 1050
SGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQGRPGAPF                           1051 - 1096
//

Text Mined References (51)

PMID Year Title