Property Summary

NCBI Gene PubMed Count 37
Grant Count 10
R01 Count 3
Funding $787,558.66
PubMed Score 36.72
PubTator Score 28.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma 1.100 0.003
Rheumatoid Arthritis 2.200 0.003
oligodendroglioma 1.300 0.021
psoriasis 1.700 0.000
osteosarcoma -1.835 0.000
astrocytoma 1.700 0.009
tuberculosis and treatment for 6 months -1.400 0.001
Alzheimer's disease 1.100 0.016
Pick disease 1.600 0.000
progressive supranuclear palsy 1.100 0.033
ovarian cancer 2.200 0.000
pituitary cancer -1.100 0.001

Gene RIF (24)

PMID Text
26397136 High KDM4B expression is associated with endometrial cancer progression.
25925418 Functional studies demonstrated that KDM4B regulates the Myc pathway. N-Myc was found to physically interact with and recruit KDM4B. KDM4B was found to regulate neuroblastoma cell proliferation and differentiation in vitro and xenograft growth in vivo.
25725194 Data indicate that miR-491-5p plays a tumor suppressor role in the development and progression of breast cancer via direct targeting the 3'UTR of JMJD2B mRNA.
25636512 JMJD2B and JMJD2C play an important role in the pathology of osteosarcoma via the up-regulation of FGF2.
25533242 results reveal that JMJD2B is dramatically upregulated in hepatocellular carcinoma, making it a potential diagnostic marker for the further development of HCC treatment therapies
24957706 Silencing of JMJD2B induces cell apoptosis via mitochondria-mediated and death receptor-mediated pathway activation in colorectal cancer.
24481461 KDM4B was upregulated in colon and rectal adenocarcinomas and required for efficient growth and clonogenic activity of human HT-29 colon cancer cells.
24473398 Jumonji domain-containing protein 2B has an essential role in cancer cell survival and tumor growth via DNA damage response mediation, which STAT3 partially regulates.
24077348 A novel function of JMJD2B in promoting epithelial-mesenchymal transition and gastric cancer invasion and metastasis.
23589305 novel pathway by which Hsp90 activity alters the histone code via regulation of KDM4B stability.
More...

AA Sequence

MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTYDDIDDVVIPA      1 - 70
PIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGS     71 - 140
LYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWY    141 - 210
AIPPEHGKRLERLAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGF    211 - 280
NHGFNCAESTNFATLRWIDYGKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTAL    281 - 350
TSPELSSWSASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE    351 - 420
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALWLPSPLEPPVL    421 - 490
GPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAFNQEHVSCQQAFEHFAQKGPT    491 - 560
WKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTFSKLKMEIKKSRRHPLGRPPTRSPLSVVKQE    561 - 630
ASSDEEASPFSGEEDVSDPDALRPLLSLQWKNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTE    631 - 700
KEAPIASLGKGCPATLPSKSRQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHAS    701 - 770
CYGIRPELVNEGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI    771 - 840
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVSITCLKHKSGG    841 - 910
HAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEG    911 - 980
ELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGAPQEPAF    981 - 1050
SGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQGRPGAPF                           1051 - 1096
//

Text Mined References (42)

PMID Year Title
26397136 2015 KDM4B and KDM4A promote endometrial cancer progression by regulating androgen receptor, c-myc, and p27kip1.
25925418 2015 The role of histone demethylase KDM4B in Myc signaling in neuroblastoma.
25725194 2015 miR-491-5p functions as a tumor suppressor by targeting JMJD2B in ER?-positive breast cancer.
25636512 2015 Histone demethylase JMJD2B and JMJD2C induce fibroblast growth factor 2: mediated tumorigenesis of osteosarcoma.
25533242 2015 JMJD2B as a potential diagnostic immunohistochemical marker for hepatocellular carcinoma: a tissue microarray-based study.
24957706 2014 Silencing of JMJD2B induces cell apoptosis via mitochondria-mediated and death receptor-mediated pathway activation in colorectal cancer.
24481461 2014 Stimulation of ?-catenin and colon cancer cell growth by the KDM4B histone demethylase.
24473398 2014 Jumonji domain-containing protein 2B silencing induces DNA damage response via STAT3 pathway in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24077348 2013 JMJD2B promotes epithelial-mesenchymal transition by cooperating with ?-catenin and enhances gastric cancer metastasis.
More...