Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.64
PubTator Score 1.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26217092 SLITRK3 expression is a highly significant predictor of gastrointestinal stromal tumor recurrence and metastasis.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNIS      1 - 70
QITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVF     71 - 140
RNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKV    141 - 210
LFYRGMLDHIGRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTEL    211 - 280
CPLLSDSEVEASLGIPHSSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQA    281 - 350
LYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLI    351 - 420
QKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFN    421 - 490
VIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEHLNAIVQIDLN    491 - 560
ENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPEMLHVAPAGESPAQPGDS    561 - 630
HLIGAPTSASPYEFSPPGGPVPLSVLILSLLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTG    631 - 700
IQMQCHRLFEDGGGGGGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSAQ    701 - 770
EAGSAERGGPGTQPPGMGEALLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHH    771 - 840
PAVGGVSGVVGGTGGDLAGFRHHEKNGGVVLFPPGGGCGSGSMLLDRERPQPAPCTVGFVDCLYGTVPKL    841 - 910
KELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTYRF       911 - 977
//

Text Mined References (9)

PMID Year Title
26217092 2015 SLITRK3 expression correlation to gastrointestinal stromal tumor risk rating and prognosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
14550773 2003 Identification and characterization of Slitrk, a novel neuronal transmembrane protein family controlling neurite outgrowth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.