Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.18
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.90159888711818E-18
lung adenocarcinoma 2714 1.2106492233798E-9
malignant mesothelioma 3163 1.86185153586055E-9
atypical teratoid / rhabdoid tumor 4369 1.59083605624039E-8
posterior fossa group B ependymoma 1530 1.41387527857168E-6
medulloblastoma, large-cell 6234 4.90790530046419E-6
lung cancer 4473 1.02365449741477E-5
pediatric high grade glioma 2712 4.23406721511351E-5
pancreatic carcinoma 567 1.17301365363542E-4
pancreatic cancer 2300 1.17301365363545E-4
ductal carcinoma in situ 1745 1.41123381699753E-4
psoriasis 6685 3.33893400441202E-4
breast carcinoma 1614 3.43078649173659E-4
invasive ductal carcinoma 2950 8.21395874369003E-4
glioblastoma 5572 0.00315660507211025
mucosa-associated lymphoid tissue lymphoma 480 0.00469485506741982
group 3 medulloblastoma 2254 0.00662692746599723
subependymal giant cell astrocytoma 2287 0.00887779510181933
osteosarcoma 7933 0.00952912486627221
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0252164185078955
Breast cancer 3099 0.0295191848252109
Disease Target Count Z-score Confidence
Hepatoblastoma 17 3.189 1.6

Expression

Synonym

Accession O94929 A8K121 Q19VH3 Q658S1 Q68CI5 Q9BV32 abLIM-3
Symbols HMFN1661

Gene

PDB

1UJS   2DJ7  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
16328021 Results characterize a third member of the actin binding LIM protein subgroup, actin binding LIM protein 3.

AA Sequence

MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYIC      1 - 70
TQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASS     71 - 140
KPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKC    141 - 210
ETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETS    211 - 280
ISPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYMSDEMLERCGYGESL    281 - 350
GTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS    351 - 420
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTY    421 - 490
HGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGY    491 - 560
EMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTT    561 - 630
RGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF                     631 - 683
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22685391 2012 Integrative approach to pain genetics identifies pain sensitivity loci across diseases.
22684256 2012 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
20709423 2010 abLIM3 is a novel component of adherens junctions with actin-binding activity.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...