Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.18
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94929 A8K121 Q19VH3 Q658S1 Q68CI5 Q9BV32 abLIM-3
Symbols HMFN1661

Gene

PDB

1UJS   2DJ7  

Gene RIF (1)

PMID Text
16328021 Results characterize a third member of the actin binding LIM protein subgroup, actin binding LIM protein 3.

AA Sequence

MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYIC      1 - 70
TQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASS     71 - 140
KPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKC    141 - 210
ETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETS    211 - 280
ISPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYMSDEMLERCGYGESL    281 - 350
GTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS    351 - 420
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTY    421 - 490
HGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGY    491 - 560
EMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTT    561 - 630
RGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF                     631 - 683
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22685391 2012 Integrative approach to pain genetics identifies pain sensitivity loci across diseases.
22684256 2012 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
20709423 2010 abLIM3 is a novel component of adherens junctions with actin-binding activity.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...