Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 3.8e-04
atypical teratoid / rhabdoid tumor 1.100 1.2e-05
group 3 medulloblastoma 1.600 7.0e-03
medulloblastoma, large-cell 1.200 5.2e-04
osteosarcoma -1.622 3.6e-06
primitive neuroectodermal tumor 1.300 1.4e-02
psoriasis -2.400 2.5e-04

AA Sequence

MELAQEARELGCWAVEEMGVPVAARAPESTLRRLCLGQGADIWAYILQHVHSQRTVKKIRGNLLWYGHQD      1 - 70
SPQVRRKLELEAAVTRLRAEIQELDQSLELMERDTEAQDTAMEQARQHTQDTQRRALLLRAQAGAMRRQQ     71 - 140
HTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRG    141 - 210
SLPTPHDDHFGTSYQQWLSSVETLLTNHPPGHVLAALEHLAAEREAEIRSLCSGDGLGDTEISRPQAPDQ    211 - 280
SDSSQTLPSMVHLIQEGWRTVGVLVSQRSTLLKERQVLTQRLQGLVEEVERRVLGSSERQVLILGLRRCC    281 - 350
LWTELKALHDQSQELQDAAGHRQLLLRELQAKQQRILHWRQLVEETQEQVRLLIKGNSASKTRLCRSPGE    351 - 420
VLALVQRKVVPTFEAVAPQSRELLRCLEEEVRHLPHILLGTLLRHRPGELKPLPTVLPSIHQLHPASPRG    421 - 490
SSFIALSHKLGLPPGKASELLLPAAASLRQDLLLLQDQRSLWCWDLLHMKTSLPPGLPTQELLQIQASQE    491 - 560
KQQKENLGQALKRLEKLLKQALERIPELQGIVGDWWEQPGQAALSEELCQGLSLPQWRLRWVQAQGALQK    561 - 630
LCS                                                                       631 - 633
//

Text Mined References (11)

PMID Year Title