Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.24
PubTator Score 22.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.58082752293159E-26
pituitary cancer 1972 1.34295119030344E-7
hepatocellular carcinoma 550 1.21072856878063E-5
posterior fossa group B ependymoma 1530 2.03825648069351E-5
psoriasis 6685 3.04721536015934E-5
cystic fibrosis 1670 5.63629170876948E-5
pancreatic cancer 2300 9.87714545870741E-4
pancreatic carcinoma 567 9.87714545870751E-4
lung cancer 4473 0.00123172200537843
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00433415158727185
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00587827220628515
osteosarcoma 7933 0.00713455451935466
glioblastoma 5572 0.0077175499745005
astrocytic glioma 2241 0.00774929288725776
pediatric high grade glioma 2712 0.00777796008096434
pilocytic astrocytoma 3086 0.0147853286803776
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0153111846952188
oligodendroglioma 2849 0.0165263688473789
subependymal giant cell astrocytoma 2287 0.0205216716320238
group 4 medulloblastoma 1875 0.0216402576792589
acute myeloid leukemia 785 0.0288772373457256
atypical teratoid / rhabdoid tumor 4369 0.0405944486763923
Disease Target Count Z-score Confidence
Asperger syndrome 35 3.562 1.8

Expression

Synonym

Accession O94923 Q6GUQ2
Symbols HSEPI

Gene

  Ortholog (13)

Gene RIF (13)

PMID Text
25594747 C5-epimerase and 2-O-sulfotransferase in association generate extended domains of consecutive GlcNS-IdoA2S Sequence.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of glucuronic acid epimerase (GLCE) in primary human brain microvascular endothelial cells
24403231 GLCE may be used as a potential model to study the functional role of intratumor cell heterogeneity in prostate cancer progression.
24264315 activation of angiogenesis as a main molecular mechanism of pro-oncogenic effect of GLCE in prostate cancer.
22968430 positive correlation between miRNA-218 and GLCE mRNA, and negative correlation between miRNA-218 and GLCE protein levels in breast tissues and primary tumors in vivo, supporting a direct involvement of miRNA-218 in posttranscriptional regulation of GLCE
22830596 Chondroitin-glucuronate C5-epimerase is a potential candidate for tumour antigen with immunogenicity and the peptides derived from this antigen could be useful in hepatocellular carcinoma immunotherapy.
22805760 A correlation was observed between D-glucuronyl C5-epimerase (GLCE), TCF4 and beta-catenin expression in breast cancer cells and primary tumors, suggesting an important role for TCF4/beta-catenin in regulating GLCE expression both in vitro and in vivo.
22528493 The biphasic mode of C(5)-epi offers a novel mechanism to regulate the biosynthesis of HS with the desired biological functions.
21654676 Loss of D-glucuronyl C-5 epimerase is associated with small-cell lung cancer.
21488854 SNPs in GLCE are associated with triglyceride and HDL-C levels in Turks, and mouse studies support a role for glce in lipid metabolism.
More...

AA Sequence

MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAK      1 - 70
QQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVY     71 - 140
GKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLSTQWGPQGYFY    141 - 210
PIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSE    211 - 280
GVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTV    281 - 350
TRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG    351 - 420
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFLSEQHGVKAVF    421 - 490
MNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLPLYDTGSGTIY    491 - 560
DLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKEFVKRWKSYLKGSRAKHN                 561 - 617
//

Text Mined References (22)

PMID Year Title
25594747 2015 C5-epimerase and 2-O-sulfotransferase associate in vitro to generate contiguous epimerized and 2-O-sulfated heparan sulfate domains.
24403231 2013 Heterogeneity of d-glucuronyl C5-epimerase expression and epigenetic regulation in prostate cancer.
24264315 2014 D-glucuronyl C5-epimerase cell type specifically affects angiogenesis pathway in different prostate cancer cells.
22968430 2012 miRNA-218 contributes to the regulation of D-glucuronyl C5-epimerase expression in normal and tumor breast tissues.
22830596 2012 Expression of chondroitin-glucuronate C5-epimerase and cellular immune responses in patients with hepatocellular carcinoma.
22805760 2012 The TCF4/?-catenin pathway and chromatin structure cooperate to regulate D-glucuronyl C5-epimerase expression in breast cancer.
22528493 2012 Uncovering biphasic catalytic mode of C5-epimerase in heparan sulfate biosynthesis.
21654676 2011 D-glucuronyl C5-epimerase suppresses small-cell lung cancer cell proliferation in vitro and tumour growth in vivo.
21488854 2011 Glucuronic acid epimerase is associated with plasma triglyceride and high-density lipoprotein cholesterol levels in Turks.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...