Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.88
PubTator Score 22.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia -1.200 8.4e-03
astrocytic glioma -1.600 7.7e-03
Astrocytoma, Pilocytic -1.100 1.4e-02
atypical teratoid / rhabdoid tumor -1.100 4.1e-02
cystic fibrosis 1.049 5.6e-05
ependymoma -1.600 1.5e-02
glioblastoma -1.200 7.7e-03
group 4 medulloblastoma 1.300 2.2e-02
hepatocellular carcinoma 1.200 1.2e-05
intraductal papillary-mucinous adenoma (... 1.900 4.3e-03
intraductal papillary-mucinous carcinoma... 1.700 5.9e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.5e-02
lung cancer 1.100 1.2e-03
lung carcinoma 1.300 1.6e-26
oligodendroglioma -1.300 1.7e-02
osteosarcoma -1.600 7.1e-03
pancreatic cancer 1.300 9.9e-04
pancreatic carcinoma 1.300 9.9e-04
pediatric high grade glioma -1.100 7.8e-03
pituitary cancer 2.000 1.3e-07
psoriasis -3.300 3.0e-05
subependymal giant cell astrocytoma -2.654 2.1e-02

Gene RIF (15)

AA Sequence

MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAK      1 - 70
QQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVY     71 - 140
GKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLSTQWGPQGYFY    141 - 210
PIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSE    211 - 280
GVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTV    281 - 350
TRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG    351 - 420
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFLSEQHGVKAVF    421 - 490
MNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLPLYDTGSGTIY    491 - 560
DLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKEFVKRWKSYLKGSRAKHN                 561 - 617
//

Text Mined References (24)

PMID Year Title