Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.24
PubTator Score 22.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94923 Q6GUQ2
Symbols HSEPI

Gene

Gene RIF (13)

PMID Text
25594747 C5-epimerase and 2-O-sulfotransferase in association generate extended domains of consecutive GlcNS-IdoA2S Sequence.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of glucuronic acid epimerase (GLCE) in primary human brain microvascular endothelial cells
24403231 GLCE may be used as a potential model to study the functional role of intratumor cell heterogeneity in prostate cancer progression.
24264315 activation of angiogenesis as a main molecular mechanism of pro-oncogenic effect of GLCE in prostate cancer.
22968430 positive correlation between miRNA-218 and GLCE mRNA, and negative correlation between miRNA-218 and GLCE protein levels in breast tissues and primary tumors in vivo, supporting a direct involvement of miRNA-218 in posttranscriptional regulation of GLCE
22830596 Chondroitin-glucuronate C5-epimerase is a potential candidate for tumour antigen with immunogenicity and the peptides derived from this antigen could be useful in hepatocellular carcinoma immunotherapy.
22805760 A correlation was observed between D-glucuronyl C5-epimerase (GLCE), TCF4 and beta-catenin expression in breast cancer cells and primary tumors, suggesting an important role for TCF4/beta-catenin in regulating GLCE expression both in vitro and in vivo.
22528493 The biphasic mode of C(5)-epi offers a novel mechanism to regulate the biosynthesis of HS with the desired biological functions.
21654676 Loss of D-glucuronyl C-5 epimerase is associated with small-cell lung cancer.
21488854 SNPs in GLCE are associated with triglyceride and HDL-C levels in Turks, and mouse studies support a role for glce in lipid metabolism.
More...

AA Sequence

MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAK      1 - 70
QQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVY     71 - 140
GKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLSTQWGPQGYFY    141 - 210
PIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSE    211 - 280
GVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTV    281 - 350
TRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG    351 - 420
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFLSEQHGVKAVF    421 - 490
MNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLPLYDTGSGTIY    491 - 560
DLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKEFVKRWKSYLKGSRAKHN                 561 - 617
//

Text Mined References (22)

PMID Year Title
25594747 2015 C5-epimerase and 2-O-sulfotransferase associate in vitro to generate contiguous epimerized and 2-O-sulfated heparan sulfate domains.
24403231 2013 Heterogeneity of d-glucuronyl C5-epimerase expression and epigenetic regulation in prostate cancer.
24264315 2014 D-glucuronyl C5-epimerase cell type specifically affects angiogenesis pathway in different prostate cancer cells.
22968430 2012 miRNA-218 contributes to the regulation of D-glucuronyl C5-epimerase expression in normal and tumor breast tissues.
22830596 2012 Expression of chondroitin-glucuronate C5-epimerase and cellular immune responses in patients with hepatocellular carcinoma.
22805760 2012 The TCF4/?-catenin pathway and chromatin structure cooperate to regulate D-glucuronyl C5-epimerase expression in breast cancer.
22528493 2012 Uncovering biphasic catalytic mode of C5-epimerase in heparan sulfate biosynthesis.
21654676 2011 D-glucuronyl C5-epimerase suppresses small-cell lung cancer cell proliferation in vitro and tumour growth in vivo.
21488854 2011 Glucuronic acid epimerase is associated with plasma triglyceride and high-density lipoprotein cholesterol levels in Turks.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...