Property Summary

Ligand Count 3
NCBI Gene PubMed Count 37
PubMed Score 25.44
PubTator Score 20.46

Knowledge Summary

Patent (2,431)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.200 9.1e-04
atypical teratoid / rhabdoid tumor -1.500 1.2e-03
Chronic Lymphocytic Leukemia 1.901 6.7e-06
glioblastoma -1.200 4.2e-02
intraductal papillary-mucinous adenoma (... -1.100 9.3e-04
intraductal papillary-mucinous carcinoma... -1.400 6.6e-04
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
lung cancer -2.000 1.8e-02
medulloblastoma, large-cell -2.300 1.1e-04
osteosarcoma 2.093 9.6e-07
ovarian cancer -1.100 2.5e-06
pancreatic cancer 1.300 6.0e-03
pancreatic carcinoma 1.300 6.0e-03
periodontitis 1.100 2.0e-29
primitive neuroectodermal tumor -1.300 1.8e-02
psoriasis -1.400 1.1e-03
sonic hedgehog group medulloblastoma -1.100 7.6e-05
ulcerative colitis 1.400 5.6e-04

 MGI Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (21)

AA Sequence

MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKK      1 - 70
VRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEK     71 - 140
LGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVF    141 - 210
EYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARA    211 - 280
KSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLG    281 - 350
TPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS    351 - 420
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH                         421 - 469
//

Text Mined References (45)

PMID Year Title