Property Summary

NCBI Gene PubMed Count 33
PubMed Score 22.36
PubTator Score 20.46

Knowledge Summary

Patent (2,431)

Expression

Synonym

Accession O94921 A4D1E6 A6NK51 A8WFP6 B4DHG5 B4DNM2 Q75N06 Q75N22 Q8N764 Q9H3D7 Q9UDR0
Symbols PFTK1
PFTAIRE1

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (17)

PMID Text
26823712 Knockdown of PFTK1 inhibited the proliferation and invasion of pancreatic cancer cells as well as the EMT progress by suppressing the PI3K/Akt signaling pathway.
26772918 The expression level of PFTK1 was correlated with tumor grade, FIGO stage, lymph node metastasis of EOC patients as well as poor prognosis.
26488471 PFTK1 overexpression promoted proliferation, migration and invasion of gastric cancer cells, while PFTK1 knockdown led to the opposite results.
26234562 Knockdown of PFTK1 increases E-cadherin expression, decreases vimentin expression and inhibits migration of glioma cells.
26033031 Up-regulated PFTK1 might promote breast cancer progression.
25680692 Cigarette smoke down regulates CDK14 levels and impairs Wnt signaling.
25472883 HIV-1 Tat specifically associates with CDK14 promoter to upregulate CDK14 expression in T cells
25028520 findings indicate that brain PP-1I associates with and is regulated by the associated protein kinases C-TAK1 and PFTK1
24794231 Human cyclin Y (CCNY) is a phosphoprotein in vivo and phosphorylation of CCNY by CDK14 triggers its ubiquitination and degradation.
24618387 binding of CCNY to 14-3-3 significantly enhanced the association between CCNY and CDK14
More...

AA Sequence

MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKK      1 - 70
VRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEK     71 - 140
LGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVF    141 - 210
EYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARA    211 - 280
KSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLG    281 - 350
TPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS    351 - 420
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH                         421 - 469
//

Text Mined References (41)

PMID Year Title
26823712 2015 Knockdown of PFTK1 inhibits tumor cell proliferation, invasion and epithelial-to-mesenchymal transition in pancreatic cancer.
26772918 2016 PFTK1 regulates cell proliferation, migration and invasion in epithelial ovarian cancer.
26488471 2015 PFTK1 Promotes Gastric Cancer Progression by Regulating Proliferation, Migration and Invasion.
26234562 2015 Knockdown of PFTK1 Inhibits the Migration of Glioma Cells.
26033031 2015 Upregulated PFTK1 promotes tumor cell proliferation, migration, and invasion in breast cancer.
25680692 2015 CDK14 expression is down-regulated by cigarette smoke in vivo and in vitro.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25028520 2014 Regulation of protein phosphatase 1I by Cdc25C-associated kinase 1 (C-TAK1) and PFTAIRE protein kinase.
24794231 2014 Phosphorylation of cyclin Y by CDK14 induces its ubiquitination and degradation.
24618387 2014 14-3-3 Binding to Cyclin Y contributes to cyclin Y/CDK14 association.
More...