Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.77
PubTator Score 0.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 5.9e-06
atypical teratoid / rhabdoid tumor -2.000 2.6e-06
glioblastoma 1.400 4.7e-03
group 3 medulloblastoma -1.600 2.1e-04
intraductal papillary-mucinous adenoma (... 2.000 1.0e-05
intraductal papillary-mucinous neoplasm ... 1.400 3.3e-02
lung cancer -1.300 2.6e-02
malignant mesothelioma -4.100 3.2e-08
medulloblastoma, large-cell -2.400 7.3e-07
osteosarcoma -1.064 2.0e-02
ovarian cancer -1.700 5.5e-05
pancreatic cancer 1.200 2.5e-04
pancreatic carcinoma 1.200 2.5e-04
progressive supranuclear palsy -1.100 2.8e-02
psoriasis -1.600 1.1e-04
ulcerative colitis -1.200 6.1e-04

Gene RIF (1)

AA Sequence

MGTARWLALGSLFALAGLLEGRLVGEEEAGFGECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYS      1 - 70
TRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQ     71 - 140
RGQLYPFSLSSDVQVATFTLTNSAPMTQSFQERWYVNLHSLMDRALTPQCGSGEDLYILTGTVPSDYRVK    141 - 210
DKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMK    211 - 280
KILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPFIKLFQLIYYLV    281 - 350
VAILKNIVYFLWCVTKQVINGIESCLYRLGSATISYFMAIGEELVSIPWKVLKVVAKVIRALLRILCCLL    351 - 420
KAICRVLSIPVRVLVDVATFPVYTMGAIPIVCKDIALGLGGTVSLLFDTAFGTLGGLFQVVFSVCKRIGY    421 - 490
KVTFDNSGEL                                                                491 - 500
//

Text Mined References (12)

PMID Year Title