Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.48
PubTator Score 0.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.25038542490038E-9
atypical teratoid/rhabdoid tumor 1095 2.26217932511133E-9
group 4 medulloblastoma 1875 3.15898213379681E-8
medulloblastoma, large-cell 6234 7.29746545553588E-7
pilocytic astrocytoma 3086 4.91458210132981E-6
ulcerative colitis 2087 6.40783670043071E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.01851180987521E-5
lung cancer 4473 2.02254550043146E-5
ovarian cancer 8492 5.54591828787886E-5
psoriasis 6685 1.08009844075567E-4
pancreatic cancer 2300 2.49009485351535E-4
pancreatic carcinoma 567 2.49009485351539E-4
osteosarcoma 7933 4.07475450868325E-4
glioblastoma 5572 0.00472832032843864
progressive supranuclear palsy 674 0.0284738756619377
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0332925578451906

Expression

  Differential Expression (16)

Synonym

Accession O94919 A8K6K8 Q6GQY5 Q8TAQ8
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with endonuclease domain containing 1 (ENDOD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MGTARWLALGSLFALAGLLEGRLVGEEEAGFGECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYS      1 - 70
TRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQ     71 - 140
RGQLYPFSLSSDVQVATFTLTNSAPMTQSFQERWYVNLHSLMDRALTPQCGSGEDLYILTGTVPSDYRVK    141 - 210
DKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMK    211 - 280
KILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPFIKLFQLIYYLV    281 - 350
VAILKNIVYFLWCVTKQVINGIESCLYRLGSATISYFMAIGEELVSIPWKVLKVVAKVIRALLRILCCLL    351 - 420
KAICRVLSIPVRVLVDVATFPVYTMGAIPIVCKDIALGLGGTVSLLFDTAFGTLGGLFQVVFSVCKRIGY    421 - 490
KVTFDNSGEL                                                                491 - 500
//

Text Mined References (12)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11921445 2002 Towards complete analysis of the platelet proteome.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
More...