Property Summary

NCBI Gene PubMed Count 83
Grant Count 62
R01 Count 44
Funding $7,651,975.35
PubMed Score 196.52
PubTator Score 127.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.300 0.015
interstitial lung disease 1.100 0.001
osteosarcoma 4.822 0.000
medulloblastoma -1.100 0.002
medulloblastoma, large-cell -1.500 0.000
tuberculosis -1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.008
adult high grade glioma -1.100 0.010
acute myeloid leukemia 1.800 0.012
psoriasis -1.700 0.000
breast carcinoma -1.400 0.000
Alzheimer's disease 1.300 0.049
Pick disease 2.800 0.000
Breast cancer -1.600 0.000
ovarian cancer 1.300 0.001

Synonym

Accession O94916 A2RRB4 A6H8V5 E9PHR7 O95693 Q7LA65 Q969Q8 Q96QH3 Q9UN18 NF-AT5
Symbols NFATZ
OREBP
NF-AT5
NFATL1
TONEBP

Gene

PANTHER Protein Class (1)

PDB

1IMH  

Gene RIF (67)

PMID Text
26912969 Our data demonstrates the involvement of TonEBP in the mechanisms responsible for osmoadaptation to hyperosmolar stress in retinal pigment epithelium cells.
26506053 Results suggest that the NFAT5 gene, which is upregulated a few hours after cocaine exposure, may be involved in the genetic predisposition to cocaine dependence.
26495302 Additionally, in peritoneal dialysis the cells of the peritoneal cavity are repeatedly exposed to a rise and fall in osmotic concentrations. Here we review the current information about NFAT5 in uremic patients and patients on peritoneal dialysis.
26299924 These results indicate that NFAT5 plays important roles in proliferation and migration of human lung adenocarcinoma cells through regulating AQP5 expression, providing a new therapeutic option for lung adenocarcinoma therapy.
25995271 Real-time PCR and Western blot analysis confirmed up-regulation of NFAT5 mRNA and NFAT5 nuclear content in human preeclamptic placentas
25928084 NFAT5 pathway activation might have a relevant role in inflammatory breast cancer pathogenesis
25878490 The hyperosmotic induction of AQP5 and VEGF in retinal pigment epithelial cells was in part dependent on activation of NFAT5.
25834072 Upregulation of NFAT5 in peritoneal dialysis patients is associated with NFkappaB induction, potentially resulting in the recruitment of macrophages
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
More...

AA Sequence

MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASS      1 - 70
APSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHT     71 - 140
VLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRP    141 - 210
GVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGK    211 - 280
ELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVT    281 - 350
GRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIM    351 - 420
RKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKS    421 - 490
EAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGALNVNVKKEIS    491 - 560
SPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGS    561 - 630
TQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPN    631 - 700
SDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQ    701 - 770
LQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSG    771 - 840
VSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQ    841 - 910
IQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTT    911 - 980
MFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGN    981 - 1050
EMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQ   1051 - 1120
STIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH   1121 - 1190
IQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQ   1191 - 1260
QQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQ   1261 - 1330
STVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYS   1331 - 1400
PQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQL   1401 - 1470
MAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF            1471 - 1531
//

Text Mined References (93)

PMID Year Title
26912969 2016 Involvement of TonEBP/NFAT5 in osmoadaptative response of human retinal pigmented epithelial cells to hyperosmolar stress.
26506053 2015 Transcriptomic and genetic studies identify NFAT5 as a candidate gene for cocaine dependence.
26495302 2015 The potential role of NFAT5 and osmolarity in peritoneal injury.
26299924 2015 NFAT5 promotes proliferation and migration of lung adenocarcinoma cells in part through regulating AQP5 expression.
25995271 2015 NFAT5 Is Up-Regulated by Hypoxia: Possible Implications in Preeclampsia and Intrauterine Growth Restriction.
25928084 2015 Systems biology analysis reveals NFAT5 as a novel biomarker and master regulator of inflammatory breast cancer.
25878490 2015 Regulation of the hyperosmotic induction of aquaporin 5 and VEGF in retinal pigment epithelial cells: involvement of NFAT5.
25834072 2015 Activation of nuclear factor of activated T cells 5 in the peritoneal membrane of uremic patients.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
More...