Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.18
PubTator Score 11.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Multiple system atrophy 29 3.0 1.5

Expression

  Differential Expression (37)

Disease log2 FC p
adrenocortical carcinoma -2.353 1.3e-02
Amyotrophic lateral sclerosis 1.282 7.9e-04
Atopic dermatitis -2.400 7.1e-04
atypical teratoid / rhabdoid tumor -2.300 5.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.774 1.0e-02
Breast cancer -1.800 6.7e-11
breast carcinoma -1.900 7.6e-06
colon cancer -3.800 3.0e-03
Crohn's disease -1.595 3.1e-02
dermatomyositis 1.100 3.9e-02
Down syndrome 1.500 2.8e-03
Duchenne muscular dystrophy 1.799 1.2e-05
ductal carcinoma in situ -2.900 4.2e-05
facioscapulohumeral dystrophy -1.500 4.7e-02
fibroadenoma -1.600 2.3e-02
group 3 medulloblastoma -2.200 2.0e-02
interstitial cystitis -1.200 1.5e-02
intraductal papillary-mucinous adenoma (... -3.600 4.1e-04
intraductal papillary-mucinous carcinoma... -4.300 2.9e-04
intraductal papillary-mucinous neoplasm ... -4.900 2.7e-04
invasive ductal carcinoma -2.980 2.3e-04
juvenile dermatomyositis 1.001 2.5e-04
lung adenocarcinoma -2.200 1.3e-11
lung cancer -2.100 5.0e-04
lung carcinoma -2.600 7.1e-19
malignant mesothelioma -4.100 4.3e-09
medulloblastoma, large-cell -3.000 1.4e-03
non diabetic and post-ischemic heart fai... 1.100 3.8e-02
non-small cell lung cancer -4.251 8.0e-36
oligodendroglioma -1.100 3.7e-03
ovarian cancer -7.800 7.5e-33
pancreatic cancer -1.300 6.9e-03
pituitary cancer -4.900 2.6e-10
posterior fossa group A ependymoma 1.400 5.5e-04
progressive supranuclear palsy -1.900 1.2e-02
psoriasis -2.100 7.4e-06
ulcerative colitis -1.561 1.9e-02

Gene RIF (7)

AA Sequence

MRKRKISVCQQTWALLCKNFLKKWRMKRESLMEWLNSLLLLLCLYIYPHSHQVNDFSSLLTMDLGRVDTF      1 - 70
NESRFSVVYTPVTNTTQQIMNKVASTPFLAGKEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFL     71 - 140
LGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVALQAAINAAIIEITTNHSVMEELMSVTGKNMK    141 - 210
MHSFIGQSGVITDLYLFSCIISFSSFIYYASVNVTRERKRMKALMTMMGLRDSAFWLSWGLLYAGFIFIM    211 - 280
ALFLALVIRSTQFIILSGFMVVFSLFLLYGLSLVALAFLMSILVKKSFLTGLVVFLLTVFWGCLGFTSLY    281 - 350
RHLPASLEWILSLLSPFAFMLGMAQLLHLDYDLNSNAFPHPSDGSNLIVATNFMLAFDTCLYLALAIYFE    351 - 420
KILPNEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAIRIRNVTKEYK    421 - 490
GKPDKIEALKDLVFDIYEGQITAILGHSGAGKSTLLNILSGLSVPTKGSVTIYNNKLSEMADLENLSKLT    491 - 560
GVCPQSNVQFDFLTVRENLRLFAKIKGILPQEVDKEIFLLDEPTAGLDPFSRHQVWNLLKERKTDRVILF    561 - 630
STQFMDEADILADRKVFLSQGKLKCAGSSLFLKKKWGIGYHLSLQLNEICVEENITSLVKQHIPDAKLSA    631 - 700
KSEGKLIYTLPLERTNKFPELYKDLDSYPDLGIENYGVSMTTLNEVFLKLEGKSTINESDIAILGEVQAE    701 - 770
KADDTERLVEMEQVLSSLNKMRKTIGGVALWRQQICAIARVRLLKLKHERKALLALLLILMAGFCPLLVE    771 - 840
YTMVKIYQNSYTWELSPHLYFLAPGQQPHDPLTQLLIINKTGASIDDFIQSVEHQNIALEVDAFGTRNGT    841 - 910
DDPSYNGAITVCCNEKNYSFSLACNAKRLNCFPVLMDIVSNGLLGMVKPSVHIRTERSTFLENGQDNPIG    911 - 980
FLAYIMFWLVLTSSCPPYIAMSSIDDYKNRARSQLRISGLSPSAYWFGQALVDVSLYFLVFVFIYLMSYI    981 - 1050
SNFEDMLLTIIHIIQIPCAVGYSFSLIFMTYVISFIFRKGRKNSGIWSFCFYVVTVFSVAGFAFSIFESD   1051 - 1120
IPFIFTFLIPPATMIGCLFLSSHLLFSSLFSEERMDVQPFLVFLIPFLHFIIFLFTLRCLEWKFGKKSMR   1121 - 1190
KDPFFRISPRSSDVCQNPEEPEGEDEDVQMERVRTANALNSTNFDEKPVIIASCLRKEYAGKRKGCFSKR   1191 - 1260
KNKIATRNVSFCVRKGEVLGLLGHNGAGKSTSIKVITGDTKPTAGQVLLKGSGGGDALEFLGYCPQENAL   1261 - 1330
WPNLTVRQHLEVYAAVKGLRKGDAEVAITRLVDALKLQDQLKSPVKTLSEGIKRKLCFVLSILGNPSVVL   1331 - 1400
LDEPSTGMDPEGQQQMWQAIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLRCIGSIQHLKSKFG   1401 - 1470
KDYLLEMKVKNLAQVEPLHAEILRLFPQAARQERYSSLMVYKLPVEDVQPLAQAFFKLEKVKQSFDLEEY   1471 - 1540
SLSQSTLEQVFLELSKEQELGDFEEDFDPSVKWKLLPQEEP                                1541 - 1581
//

Text Mined References (23)

PMID Year Title