Property Summary

NCBI Gene PubMed Count 15
PubMed Score 60.45
PubTator Score 154.84

Knowledge Summary

Patent (13,913)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 3.5e-05
colon cancer 1.600 1.6e-02
cystic fibrosis -1.373 2.7e-04
ependymoma -1.100 1.4e-09
glioblastoma -1.100 1.0e-05
group 3 medulloblastoma -1.500 3.9e-04
lung carcinoma 1.100 3.6e-21
malignant mesothelioma 2.500 9.2e-07
medulloblastoma, large-cell -1.300 5.9e-03
osteosarcoma 1.018 3.1e-02
psoriasis -1.100 2.7e-03
subependymal giant cell astrocytoma -1.322 4.2e-02

Gene RIF (3)

AA Sequence

MARLAAVLWNLCVTAVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVENANYGRTDDKI      1 - 70
CDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVPYKVEQKVFVC     71 - 140
PGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWIPYRTDTLTEYASWEDYVAARHTTTYRLPNR    141 - 210
VDGTGFVVYDGAVFYNKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVI    211 - 280
YATEGNNGRLVVSQLNPYTLRFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNT    281 - 350
NANREEPVSLTFPNPYQFISSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPT    351 - 420
PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPVPSTRRPPAPNLHVSPELFCEPREVRRVQW    421 - 490
PATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSNCTSPWVNQVAQKIKSGENAANIASELARH    491 - 560
TRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAGKNYNKMHKRERTCKDYIKAVVETVDNLLRP    561 - 630
EALESWKDMNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAAKENVVLEVTVLNTEGQVQELVFPQE    631 - 700
EYPRKNSIQLSAKTIKQNSRNGVVKVVFILYNNLGLFLSTENATVKLAGEAGPGGPGGASLVVNSQVIAA    701 - 770
SINKESSRVFLMDPVIFTVAHLEDKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTN    771 - 840
FAVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCINLFLAELLF    841 - 910
LVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPALVVGI    911 - 980
AAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLVFLMVTLHKMIRSSSVLKPDSSRLDNIKSWA    981 - 1050
LGAIALLFLLGLTWAFGLLFINKESVVMAYLFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIR   1051 - 1120
SPPGGTHGSLKTSAMRSNTRYYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPV   1121 - 1190
LQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFP   1191 - 1260
PGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAKGPPPPEPPVPPVPGGGGEEEAGGPGGADR   1261 - 1330
AEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPGRDSLYASGANLRDSPSYPDS   1331 - 1400
SPEGPSEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGYYQVRRPSHEGYLAAPGLEGPGPDGDGQMQL   1401 - 1470
VTSL                                                                     1471 - 1474
//

Text Mined References (15)

PMID Year Title