Property Summary

NCBI Gene PubMed Count 312
Grant Count 259
R01 Count 145
Funding $20,827,118.26
PubMed Score 552.45
PubTator Score 570.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession O94907 B2RC19 Dickkopf-1
Symbols SK
DKK-1

Gene

PDB

3S2K   3S8V   3SOQ   5FWW  

Gene RIF (280)

PMID Text
27015306 Through expression of the WNT inhibitor DKK1, latency competent cancer cells self-impose a slow-cycling state with broad downregulation of ULBP ligands for NK cells and evasion of NK-cell-mediated clearance.
26986465 AFP remained the best single marker, and the combined use of AFP with prothrombin precursor or DKK-1 had the best diagnostic performance compared to all other possible combinations of the four biomarkers, even in early stage hepatocellular carcinoma.
26927559 Data indicate that in rheumatoid arthritis patients, level of receptor activator of nuclear factor-kappaB ligand (RANKL) on T cells is elevated, and the serum level of RANKL increases, but Dickkopf1 protein (DKK1) decreases.
26782930 Synovial fibroblasts from patients with very early rheumatoid arthritis expressed significantly higher levels of DKK1 compared to patients with resolving arthritis.
26782539 Low DKK-1 serum levels are associated with poor prognosis in papillary thyroid cancer patients; DKK-1 could potentially be used as a biomarker leading to earlier diagnosis of papillary thyroid cancer.
26782465 High serum DKK-1 levels may be associated with tumor progression and poor prognosis in bladder cancer and may be used as a potential biomarker to predict the prognosis of patients with bladder cancer
26780085 DKK1 polymorphisms may correlate to baseline bone mineral density and serum beta-CTX levels, but present a weak effect on the response to alendronate.
26545120 SOST and DKK1 have opposing effects on PC3 cell invasion and bone-derived Wnt signaling positively contributes to the invasive phenotypes of PC3
26407843 Immunohistochemical analysis of DKK-1 expression in 97 breast cancer samples revealed that high expression of p38 was associated with a higher expression of DKK-1 compared to tumours with low p38 expression.
26400224 miR-152 blocked DKK1 transcriptional activity by binding to the 3'UTR of DKK1 mRNA.
More...

AA Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPG      1 - 70
GNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVS     71 - 140
SDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKIC    141 - 210
KPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH                  211 - 266
//

Text Mined References (314)

PMID Year Title
27015306 2016 Metastatic Latency and Immune Evasion through Autocrine Inhibition of WNT.
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26927559 2016 [RANKL increases on peripheral blood T lymphocytes and serum Dickkopf1 decreases in rheumatoid arthritis].
26782930 2016 DKK1 expression by synovial fibroblasts in very early rheumatoid arthritis associates with lymphocyte adhesion in an in vitro flow co-culture system.
26782539 2015 Downregulation of serum DKK-1 predicts poor prognosis in patients with papillary thyroid cancer.
26782465 2015 Serum Dickkopf-1 levels as a clinical and prognostic factor in patients with bladder cancer.
26780085 2016 The analysis of DKK1 polymorphisms in relation to skeletal phenotypes and bone response to alendronate treatment in Chinese postmenopausal women.
26545120 2015 SOST Inhibits Prostate Cancer Invasion.
26407843 2015 P38 regulates the Wnt inhibitor Dickkopf-1 in breast cancer.
26400224 2015 Downregulation of MicroRNA-152 contributes to high expression of DKK1 in multiple myeloma.
More...