Property Summary

NCBI Gene PubMed Count 365
PubMed Score 621.77
PubTator Score 570.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.500 1.5e-02
chronic rhinosinusitis 1.139 1.6e-02
cutaneous lupus erythematosus 1.900 4.3e-02
cystic fibrosis 1.200 2.1e-02
esophageal adenocarcinoma -1.200 2.5e-02
glioblastoma 2.600 5.2e-03
group 3 medulloblastoma -1.700 3.4e-04
interstitial cystitis -2.500 1.4e-03
lung cancer 7.800 2.1e-08
Multiple myeloma 2.512 6.6e-03
non diabetic and post-ischemic heart fai... -1.400 2.8e-02
non-small cell lung cancer 1.301 1.3e-03
pancreatic cancer 3.500 9.2e-07
pediatric high grade glioma 1.900 1.9e-02
psoriasis -1.100 1.2e-04
ulcerative colitis 2.100 1.2e-02

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (329)

AA Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPG      1 - 70
GNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVS     71 - 140
SDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKIC    141 - 210
KPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH                  211 - 266
//

Text Mined References (367)

PMID Year Title