Property Summary

NCBI Gene PubMed Count 35
PubMed Score 24.48
PubTator Score 715.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
RETINITIS PIGMENTOSA 60 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Retinitis Pigmentosa 226

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.100 1.2e-02
Gaucher disease type 1 -1.300 9.9e-03
glioblastoma 1.200 4.7e-03
group 4 medulloblastoma 1.200 9.8e-03
medulloblastoma, large-cell 1.100 3.5e-03
oligodendroglioma 1.500 3.2e-03
ovarian cancer 1.400 3.5e-06
pituitary cancer 1.100 5.0e-03
psoriasis -1.400 3.5e-03
Rheumatoid arthritis 1.500 1.7e-03

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDD      1 - 70
EDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQ     71 - 140
QFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGL    141 - 210
NTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSM    211 - 280
IPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAA    281 - 350
RLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR    351 - 420
IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRA    421 - 490
ITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR    491 - 560
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSI    561 - 630
LALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEE    631 - 700
ALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSR    701 - 770
LKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHD    771 - 840
PHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGE    841 - 910
LWCAVSKDIANWQKKIGDILRLVAGRIKNTF                                           911 - 941
//

Text Mined References (43)

PMID Year Title