Property Summary

NCBI Gene PubMed Count 35
Grant Count 67
R01 Count 49
Funding $7,021,985.71
PubMed Score 27.62
PubTator Score 715.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.002
ependymoma 1.100 0.012
oligodendroglioma 1.500 0.003
psoriasis -1.400 0.004
glioblastoma 1.200 0.005
medulloblastoma 1.300 0.001
medulloblastoma, large-cell 1.100 0.003
ovarian cancer 1.400 0.000
Gaucher disease type 1 -1.300 0.010
pituitary cancer 1.100 0.005

Synonym

Accession O94906 B2RAR5 B3KMC6 O95109 Q5VXS5 Q9H3Z1 Q9H4T9 Q9H4U8 Q9NTE6
Symbols TOM
ANT1
Prp6
RP60
ANT-1
hPrp6
U5-102K
C20orf14
SNRNP102

Gene

PDB

3JCR  

Gene RIF (9)

PMID Text
24788092 an essential role for PRPF6 in cancer via splicing of distinct growth-related gene products.
22174317 HIV-1 Rev interacting protein, pre-mRNA processing factor 6 homolog (PRPF6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PRPF6 is increased by RRE
21549338 Our results identify PRPF6 as the sixth gene involved in pre-mRNA splicing and dominant RP, corroborating the hypothesis that deficiencies in the spliceosome play an important role in the molecular pathology of this disease.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20118938 The authors provide evidence that PRP6 and PRP31 are directly phosphorylated by human PRP4 kinase (PRP4K) concomitant with their incorporation into B complexes.
18854154 Knockdown of PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae, PRPF6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18278469 C20orf14 may have a role in progression of lymphoma
15840814 The interaction of CD2BP2 with a tri-snRNP bridging protein (Prp6), coupled with CD2BP2's absence from the tri-snRNP, suggests it might function in tri-snRNP assembly
12039962 identification as a coactivator for the androgen receptor [p102 U5 small nuclear ribonucleoprotein particle-binding protein]

AA Sequence

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDD      1 - 70
EDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQ     71 - 140
QFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGL    141 - 210
NTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSM    211 - 280
IPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAA    281 - 350
RLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR    351 - 420
IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRA    421 - 490
ITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR    491 - 560
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSI    561 - 630
LALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEE    631 - 700
ALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSR    701 - 770
LKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHD    771 - 840
PHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGE    841 - 910
LWCAVSKDIANWQKKIGDILRLVAGRIKNTF                                           911 - 941
//

Text Mined References (43)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24788092 2014 An integrative analysis of colon cancer identifies an essential function for PRPF6 in tumor growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22235333 2012 Mutations in the gene DNAJC5 cause autosomal dominant Kufs disease in a proportion of cases: study of the Parry family and 8 other families.
21549338 2011 A missense mutation in PRPF6 causes impairment of pre-mRNA splicing and autosomal-dominant retinitis pigmentosa.
More...