Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.62
PubTator Score 20.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count Z-score Confidence
Paraplegia 74 3.916 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.700 2.1e-02
Astrocytoma, Pilocytic 1.200 1.1e-05
atypical teratoid / rhabdoid tumor 1.200 6.5e-06
Breast cancer 2.000 4.7e-02
Down syndrome 1.100 5.7e-04
ependymoma 1.700 6.7e-17
glioblastoma 1.200 3.3e-05
interstitial cystitis -1.200 3.2e-04
osteosarcoma -2.159 1.7e-03
ovarian cancer -1.500 1.9e-07
primitive neuroectodermal tumor 1.100 7.4e-03
psoriasis -1.200 8.7e-07

Protein-protein Interaction (8)

Gene RIF (15)

AA Sequence

MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDE      1 - 70
VKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIEL     71 - 140
FDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETE    141 - 210
RKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEY    211 - 280
LQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN               281 - 339
//

Text Mined References (35)

PMID Year Title