Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.42
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (2)

AA Sequence

MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYV      1 - 70
QELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLK     71 - 140
VMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCK    141 - 210
KLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH         211 - 275
//

Text Mined References (17)

PMID Year Title