Property Summary

NCBI Gene PubMed Count 37
Grant Count 18
R01 Count 11
Funding $1,892,265.03
PubMed Score 48.17
PubTator Score 30.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (26)

PMID Text
26476453 SUN1 plays a role in hnRNP-involved mRNA export.
26356418 Nuclear envelope associated endosome-mediated transfer depends on the nuclear envelope proteins SUN1 and SUN2, as well as the Sec61 translocon complex.
25482198 these data support a model whereby mitotic phosphorylation of SUN1 disrupts interactions with nucleoplasmic binding partners, promoting disassembly of the nuclear lamina and, potentially, its chromatin interactions
25210889 An important role for SUN1 and SUN2 in muscle disease pathogenesis.
25057012 The Caenorhabditis elegans lamin, LMN-1, is required for nuclear migration and interacts with the nucleoplasmic domain of the SUN protein UNC-84.
24662567 Codepletion of SUN1/2 slows cell proliferation and results in an accumulation of morphologically defective and disoriented mitotic spindles.
24522183 Farnesylation of progerin enhances its interaction with SUN1 and reduces SUN1 mobility.
24375709 Results highlight the interactions at the nuclear envelope where mutations in the EMD and TMPO gene in combination with mutations in SUN1 have an impact on several components of the network.
22541428 Reduction of SUN1 overaccumulation in LMNA mutant fibroblasts and in cells derived from HGPS patients corrected nuclear defects and cellular senescence.
22190034 HIV-1 gp160 is identified to have a physical interaction with Sad1 and UNC84 domain containing 1 (SUN1; UNC84A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEA      1 - 70
VGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWI     71 - 140
REQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSR    141 - 210
VYSRDRNQKCDDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG    211 - 280
KAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLRGQGNFFSFLPVLNW    281 - 350
ASMHRTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKL    351 - 420
QARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKT    421 - 490
ISAVGEQLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQL    491 - 560
LQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSAL    561 - 630
KLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKG    631 - 700
SQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQM    701 - 770
FQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK                                771 - 812
//

Text Mined References (45)

PMID Year Title
26476453 2015 Inner nuclear envelope protein SUN1 plays a prominent role in mammalian mRNA export.
26356418 2015 Nuclear envelope-associated endosomes deliver surface proteins to the nucleus.
25482198 Mitotic phosphorylation of SUN1 loosens its connection with the nuclear lamina while the LINC complex remains intact.
25210889 2014 Muscular dystrophy-associated SUN1 and SUN2 variants disrupt nuclear-cytoskeletal connections and myonuclear organization.
25057012 2014 The Caenorhabditis elegans SUN protein UNC-84 interacts with lamin to transfer forces from the cytoplasm to the nucleoskeleton during nuclear migration.
24662567 2014 SUN proteins facilitate the removal of membranes from chromatin during nuclear envelope breakdown.
24522183 2014 Dysregulated interactions between lamin A and SUN1 induce abnormalities in the nuclear envelope and endoplasmic reticulum in progeric laminopathies.
24375709 2014 Contribution of SUN1 mutations to the pathomechanism in muscular dystrophies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...