Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 5
Funding $287,615.16
PubMed Score 11.24
PubTator Score 15.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94898 Q9NSN2 LIG-2
Symbols LIG2
UFS2
LIG-2

Gene

PANTHER Protein Class (1)

Gene RIF (8)

PMID Text
23313374 A subset of urofacial syndrome-affected individuals have biallelic mutations in LRIG2
22484910 Cytoplasmic expression of LRIG2 is associated with meningiomas.
21823015 LRIG2 gene is overexpressed in invasive pituitary adenoma.
21632100 LRIG1 and LRIG2 expressions were seen in precancerous cervical epithelium and found to increase with increasing grade.
20446891 Observational study of gene-disease association. (HuGE Navigator)
18992012 This is the first report of an LRIG protein showing a negative effect on survival, suggesting that LRIG2 might have a function different from that of LRIG1, and possibly contributing to the etiology of oligodendroglioma.
18037903 LRIG proteins may have a role in epidermal homeostasis and psoriasis
15145052 LRIG2 was found to be a glycoprotein with an molecular weight of 132 kDa, which was encoded by a gene on human chromosome 1p13 and its mRNA was present in all tissues analyzed.

AA Sequence

MAPAPLGVPEEQLLGCRSRVLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRKLPAPSWRALS      1 - 70
GLLPPDTAILDFSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTSNITLLSLVHNIIPEINAQAL     71 - 140
QFYPALESLDLSSNIISEIKTSSFPRMQLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRMSMIPPK    141 - 210
IFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNK    211 - 280
GWLYGLRMLQQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHI    281 - 350
ADGVFRFLSNLQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNN    351 - 420
AIMSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQSILNVDLKDF    421 - 490
VCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEILYDVDTENFVRYWQQAGEALE    491 - 560
YTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNEMPSFLKTPMDLTIRTGAMARLECAAEGHPA    561 - 630
PQISWQKDGGTDFPAARERRMHVMPEDDVFFIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIR    631 - 700
PLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSN    701 - 770
TLGTERGHIYLNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI    771 - 840
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVICSDCYDNAN    841 - 910
IYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNHERISE    911 - 980
KKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF    981 - 1050
DFSRTRNIQDGSEGT                                                          1051 - 1065
//

Text Mined References (20)

PMID Year Title
25353163 2014 Soluble LRIG2 ectodomain is released from glioblastoma cells and promotes the proliferation and inhibits the apoptosis of glioblastoma cells in vitro and in vivo in a similar manner to the full-length LRIG2.
25180912 2014 LRIG and cancer prognosis.
25013483 2014 LRIG2 expression and prognosis in non-small cell lung cancer.
23313374 2013 LRIG2 mutations cause urofacial syndrome.
22484910 2012 Immunohistochemical analysis of LRIG proteins in meningiomas: correlation between estrogen receptor status and LRIG expression.
21823015 2011 Association of expression of Leucine-rich repeats and immunoglobulin-like domains 2 gene with invasiveness of pituitary adenoma.
21632100 2011 Correlation between LRIG1 and LRIG2 expressions and expression of 11 tumor markers, with special reference to tumor suppressors, in CIN and normal cervical epithelium.
20553099 2010 LRIG2 in contrast to LRIG1 predicts poor survival in early-stage squamous cell carcinoma of the uterine cervix.
20446891 2010 A comprehensive study of the association between the EGFR and ERBB2 genes and glioma risk.
19421009 2009 Downregulation of LRIG2 expression by RNA interference inhibits glioblastoma cell (GL15) growth, causes cell cycle redistribution, increases cell apoptosis and enhances cell adhesion and invasion in vitro.
More...