Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.23
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 2.200 2.7e-02
colon cancer 1.500 4.5e-02
group 3 medulloblastoma 1.100 3.6e-02
intraductal papillary-mucinous adenoma (... 1.200 2.2e-02
malignant mesothelioma -2.100 9.2e-08
medulloblastoma, large-cell -1.100 5.5e-03
ovarian cancer -1.300 6.0e-06
posterior fossa group B ependymoma 1.200 1.1e-04
psoriasis -1.500 4.2e-08

Gene RIF (1)

AA Sequence

MINAQELLTLEDVTVEFTWEEWQLLGPFQKDLYRDVMLEIYSNLLSMGYQVSKPDALSKLERGEEPWTME      1 - 70
DERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSLCLFRENHDTFELYIKTLKSN     71 - 140
LSLVNQNKSCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEIEKNHVCSEC    141 - 210
GKAFVKKSQLTDHERVHTGEKPYGCTLCAKVFSRKSRLNEHQRIHKREKSFICSECGKVFTMKSRLIEHQ    211 - 280
RTHTGEKPYICNECGKGFPGKRNLIVHQRNHTGEKSYICSECGKGFTGKSMLIIHQRTHTGEKPYICSEC    281 - 350
GKGFTTKHYVIIHQRNHTGEKPYICNECGKGFTMKSRMIEHQRTHTGEKPYICSECGKGFPRKSNLIVHQ    351 - 420
RNHTVEKSYLCSECGKGFTVKSMLIIHQRTHTGEKPYTCSECGKGFPLKSRLIVHQRTHTGEKPYRCSEC    421 - 490
GKGFIVNSGLMLHQRTHTGEKPYICNECGKGFAFKSNLVVHQRTHTGEKPFMCSECGKGFTMKRYLIVHQ    491 - 560
QIHTEEKSCICSECGRGFAKETELALHKQVHTGEKPYGCNECGKGFTMKSRLIVHQRTHTGEKPFVCSEC    561 - 630
RKAFSSKRNLIVHQRTHNGNKP                                                    631 - 652
//

Text Mined References (7)

PMID Year Title