Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.400 0.040
osteosarcoma -1.477 0.000
astrocytoma -1.100 0.043
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.001
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.500 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.000
intraductal papillary-mucinous carcinoma... 1.800 0.008
adult high grade glioma -1.100 0.004
lung carcinoma -1.700 0.000
Pick disease -1.300 0.000
progressive supranuclear palsy -1.300 0.007
ovarian cancer -1.100 0.000

Synonym

Accession O94886 Q53GI7 Q5TE96 Q8N2U2
Symbols KIAA0792

Gene

 GO Function (1)

 GO Process (1)

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of transmembrane protein 63A (TMEM63A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MMDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFLFLILVFSI      1 - 70
IRRRFWDYGRIALVSEADSESRFQRLSSTSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYL     71 - 140
SFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGRTTIANLQTDNDLLWLHTIFAVIYLFLTVGF    141 - 210
MRHHTQSIKYKEENLVRRTLFITGLPRDARKETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTE    211 - 280
KSLTYYTNLQVKTGQRTLINPKPCGQFCCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMA    281 - 350
FVTFQEKSMATYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWL    351 - 420
QWLGINFTLFLGLFFLTTPSIILSTMDKFNVTKPIHALNNPIISQFFPTLLLWSFSALLPSIVYYSTLLE    421 - 490
SHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEASIRLECVFLPDQGAFFVNYV    491 - 560
IASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYSITCPI    561 - 630
IAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAAPILCLFWLYFFSFLRLGMKAPATLFT    631 - 700
FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTALSPQ    701 - 770
QQQQQTYGAIHNISGTIPGQCLAQSATGSVAAAPQEA                                     771 - 807
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20957757 2010 The proteome of lysosomes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...