Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 4.0e-03
astrocytoma -1.100 4.3e-02
atypical teratoid / rhabdoid tumor -1.100 4.8e-05
ependymoma 1.400 4.0e-02
glioblastoma -1.100 1.3e-03
group 3 medulloblastoma -1.300 1.1e-02
intraductal papillary-mucinous adenoma (... 1.300 1.8e-03
intraductal papillary-mucinous carcinoma... 1.800 7.9e-03
lung carcinoma -1.700 8.5e-27
medulloblastoma, large-cell -1.500 1.6e-04
osteosarcoma -1.477 3.8e-05
ovarian cancer -1.100 2.2e-04
Pick disease -1.300 2.5e-04
progressive supranuclear palsy -1.300 7.2e-03

 GO Function (1)

Gene RIF (3)

AA Sequence

MMDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFLFLILVFSI      1 - 70
IRRRFWDYGRIALVSEADSESRFQRLSSTSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYL     71 - 140
SFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGRTTIANLQTDNDLLWLHTIFAVIYLFLTVGF    141 - 210
MRHHTQSIKYKEENLVRRTLFITGLPRDARKETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTE    211 - 280
KSLTYYTNLQVKTGQRTLINPKPCGQFCCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMA    281 - 350
FVTFQEKSMATYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWL    351 - 420
QWLGINFTLFLGLFFLTTPSIILSTMDKFNVTKPIHALNNPIISQFFPTLLLWSFSALLPSIVYYSTLLE    421 - 490
SHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEASIRLECVFLPDQGAFFVNYV    491 - 560
IASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYSITCPI    561 - 630
IAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAAPILCLFWLYFFSFLRLGMKAPATLFT    631 - 700
FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTALSPQ    701 - 770
QQQQQTYGAIHNISGTIPGQCLAQSATGSVAAAPQEA                                     771 - 807
//

Text Mined References (14)

PMID Year Title