Property Summary

NCBI Gene PubMed Count 39
PubMed Score 32.97
PubTator Score 25.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Alopecia 55
Diabetic Nephropathy 37
Disease Target Count P-value
non-small cell lung cancer 2798 3.03313607916847E-18
lung carcinoma 2844 6.51876317428803E-18
lung adenocarcinoma 2714 1.32488369639817E-14
juvenile dermatomyositis 1189 1.21453294263277E-12
ovarian cancer 8492 1.05544287055638E-11
malignant mesothelioma 3163 7.88602675390066E-8
pituitary cancer 1972 6.52323110999227E-7
medulloblastoma, large-cell 6234 6.23234966155824E-6
group 4 medulloblastoma 1875 1.72751126092447E-5
breast carcinoma 1614 1.82969198293491E-5
Duchenne muscular dystrophy 602 1.83481471160965E-5
lung cancer 4473 2.86061471638611E-5
cystic fibrosis 1670 7.00543745183094E-5
Pick disease 1893 1.02806746191075E-4
ductal carcinoma in situ 1745 1.0702939386667E-4
acute quadriplegic myopathy 1157 2.02075436191825E-4
Breast cancer 3099 0.00101022007425518
invasive ductal carcinoma 2950 0.00136388096720542
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00169229062897738
nasopharyngeal carcinoma 1056 0.00340583636289467
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00372098973262253
cutaneous lupus erythematosus 1056 0.00804968235526795
osteosarcoma 7933 0.017581155378
esophageal adenocarcinoma 737 0.0195207517873976
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0230441502394646
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0255312047876676
spina bifida 1064 0.026905982052635
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0277012918658424
mucosa-associated lymphoid tissue lymphoma 480 0.045330848461779
Disease Target Count Z-score Confidence
Dyschromatosis universalis hereditaria 5 4.144 2.1
Disease Target Count
Lentiginosis, Inherited Patterned 1

Expression

Synonym

Accession O94885 Q5TGN5 Q8TAI0 Q9H7R7
Symbols SH3D6A
dJ323M4.1

Gene

PDB

2DL0   2EBP  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (18)

PMID Text
26424902 SASH1 expression strongly correlated with glioma grades, showing higher expression at a lower grade.
26350878 Two SNPs were significantly associated with rotator cuff tearing, residing in SAP30BP on chromosome 17 and SASH1 on chromosome 6.
26318107 SASH1 expression is increased in atherosclerotic carotids in smokers and its silencing affects endothelial angiogenic functions
26203640 SASH1 Is Involved in an Autosomal Dominant Lentiginous Phenotype.
25315659 Data suggest that SASH1 (SAM and SH3 domain-containing protein 1) should be added to the list of genes responsible for autosomal-dominant and -recessive genodermatosis.
24344014 Propose that increase of DNA methylation level in the promoter region of gene SASH1, particularly CpG_26.27 or CpG_54.55 sites, possibly repressed SASH1 expression in breast cancer.
23333244 SASH1 regulates IQGAP1-E-Cadherin signalling and crosstalking between GPCR signalling, calmodulin signalling for the modulation of melanocytes invasion.
23108792 Overexpression of SASH1 might be associated with the inhibition of growth, proliferation, and invasion osteosarcoma cells.
23023727 The SASH1 gene is blocked cyclin B1-Cdc2 binding, either directly or indirectly, leading to G2/M arrest.
22915266 Loss of SASH1 is associated with glioma.
More...

AA Sequence

MEDAGAAGPGPEPEPEPEPEPEPAPEPEPEPKPGAGTSEAFSRLWTDVMGILDGSLGNIDDLAQQYADYY      1 - 70
NTCFSDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDS     71 - 140
SVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARL    141 - 210
KEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKLIRVEE    211 - 280
MKKPSTEGGEEHVFENSPVLDERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSLDTWGAGRKL    281 - 350
VKTFSKGESRGLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHV    351 - 420
GSNNSDPMGKEGDFVYKEVIKSPTASRISLGKKVKSVKETMRKRMSKKYSSSVSEQDSGLDGMPGSPPPS    421 - 490
QPDPEHLDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRAR    491 - 560
VHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSEDEEKPKRPTRRRRKG    561 - 630
RPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSN    631 - 700
SDQSGSQEKLLVDSQGLSGCSPRDSGCYESSENLENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLP    701 - 770
LMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSHSL    771 - 840
DDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQPLEQDSAVDNALLLTQSKRFSEPQKLTTKK    841 - 910
LEGSIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGTHHPLGTKEGVDAEQRMQPKI    911 - 980
PSQPPPVPAKKSRERLANGLHPVPMGPSGALPSPDAPCLPVKRGSPASPTSPSDCPPALAPRPLSGQAPG    981 - 1050
SPPSTRPPPWLSELPENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRC   1051 - 1120
GIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPGCISSVSDWLISIG   1121 - 1190
LPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAM                1191 - 1247
//

Text Mined References (44)

PMID Year Title
27659786 2016 Lentiginous phenotypes caused by diverse pathogenic genes (SASH1 and PTPN11): clinical and molecular discrimination.
27637080 2016 SASH1 mediates sensitivity of breast cancer cells to chloropyramine and is associated with prognosis in breast cancer.
27198373 2016 16P The overexpression of SASH1 stimulates cell death in lung cancer cells.
27178819 2016 Overexpression of SASH1 Inhibits the Proliferation, Invasion, and EMT in Hepatocarcinoma Cells.
27178818 2016 Overexpression of SASH1 Inhibits TGF-?1-Induced EMT in Gastric Cancer Cells.
27123075 2016 Downregulation of SASH1 correlates with tumor progression and poor prognosis in ovarian carcinoma.
26935246 2016 SASH1 inhibits cervical cancer cell proliferation and invasion by suppressing the FAK pathway.
26424902 2015 Clinical Significance of SASH1 Expression in Glioma.
26350878 2016 Genome-wide association study for rotator cuff tears identifies two significant single-nucleotide polymorphisms.
26318107 2015 SASH1, a new potential link between smoking and atherosclerosis.
More...