Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.79
PubTator Score 2.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.108 9.4e-07
astrocytic glioma -1.100 4.1e-02
atypical teratoid / rhabdoid tumor -1.100 2.2e-02
glioblastoma 1.100 7.1e-05
group 3 medulloblastoma 2.300 3.8e-05
intraductal papillary-mucinous adenoma (... 1.300 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.700 3.7e-02
malignant mesothelioma 1.300 1.3e-05
medulloblastoma, large-cell 1.100 9.8e-04
nasopharyngeal carcinoma 1.100 8.2e-05
oligodendroglioma -1.200 3.4e-02
osteosarcoma -1.101 2.7e-02
primitive neuroectodermal tumor 1.100 6.7e-04
psoriasis -1.900 8.7e-04

Gene RIF (2)

AA Sequence

MDRSSKRRQVKPLAASLLEALDYDSSDDSDFKVGDASDSEGSGNGSEDASKDSGEGSCSDSEENILEEEL      1 - 70
NEDIKVKEEQLKNSAEEEVLSSEKQLIKMEKKEEEENGERPRKKKEKEKEKEKEKEKEKEREKEKEKATV     71 - 140
SENVAASAAATTPATSPPAVNTSPSVPTTTTATEEQVSEPKKWNLRRNRPLLDFVSMEELNDMDDYDSED    141 - 210
DNDWRPTVVKRKGRSASQKEGSDGDNEDDEDEGSGSDEDENDEGNDEDHSSPASEGGCKKKKSKVLSRNS    211 - 280
ADDEELTNDSLTLSQSKSNEDSLILEKSQNWSSQKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGC    281 - 350
YGVDGESDSIMSSASENSTEPWFCDACKCGVSPSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDI    351 - 420
DKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADP    421 - 490
FFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWV    491 - 560
PREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRM    561 - 630
IQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGIWALLGRITGQKLNIPAIL    631 - 700
RAPKERKPSKKEGGTQKTSTLPAVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSY    701 - 770
WQCSECDQAGSSDMEADMAMETLPDGTKRSRRQIKEPVKFVPQDVPPEPKKIPIRNTRTRGRKRSFVPEE    771 - 840
EKHEERVPRERRQRQSVLQKKPKAEDLRTECATCKGTGDNENLVRYPS                          841 - 888
//

Text Mined References (21)

PMID Year Title