Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.64
PubTator Score 6.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.70823988224852E-8
ependymoma 2514 4.68790572842038E-7
Pick disease 1893 9.16201298634003E-6
ovarian cancer 8492 4.55077088738447E-5
adult high grade glioma 2148 4.562131583372E-5
medulloblastoma, large-cell 6234 5.68117019415653E-5
pituitary cancer 1972 7.63860612119915E-5
dermatomyositis 967 1.60701486782449E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.11878336103106E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.53114114904573E-4
glioblastoma 5572 7.43673929692331E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00323221421881895
subependymal giant cell astrocytoma 2287 0.00702279895562658
atypical teratoid / rhabdoid tumor 4369 0.00734811084435584
hepatocellular carcinoma 550 0.00933952863339768
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0156067482098424
progressive supranuclear palsy 674 0.0158292033789119
spina bifida 1064 0.0169183603063709
Disease Target Count Z-score Confidence
Cervical cancer 23 3.087 1.5

Expression

Synonym

Accession O94876 A8K5Y3 B4DE04 Q68E06 Q8IXM8
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
24454821 roles of TMCC1 in ER organization
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEPSGSEQLFEDPDPGGKSQDAEARKQTESEQKLSKMTHNALENINVIGQGLKHLFQHQRRRSSVSPHDV      1 - 70
QQIQADPEPEMDLESQNACAEIDGVPTHPTALNRVLQQIRVPPKMKRGTSLHSRRGKPEAPKGSPQINRK     71 - 140
SGQEMTAVMQSGRPRSSSTTDAPTSSAMMEIACAAAAAAAACLPGEEGTAERIERLEVSSLAQTSSAVAS    141 - 210
STDGSIHTDSVDGTPDPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLKLANSADKQQAARIKQV    211 - 280
FEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPRQPKDVFRDMHQGLKDVGAKVTGFSEGVVDSVKGG    281 - 350
FSSFSQATHSAAGAVVSKPREIASLIRNKFGSADNIPNLKDSLEEGQVDDAGKALGVISNFQSSPKYGSE    351 - 420
EDCSSATSGSVGANSTTGGIAVGASSSKTNTLDMQSSGFDALLHEIQEIRETQARLEESFETLKEHYQRD    421 - 490
YSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRIS    491 - 560
KMELQQQQQQVVQLEGLENATARNLLGKLINILLAVMAVLLVFVSTVANCVVPLMKTRNRTFSTLFLVVF    561 - 630
IAFLWKHWDALFSYVERFFSSPR                                                   631 - 653
//

Text Mined References (18)

PMID Year Title
24454821 2014 Transmembrane and coiled-coil domain family 1 is a novel protein of the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...