Property Summary

NCBI Gene PubMed Count 48
Grant Count 3
R01 Count 3
Funding $219,770.07
PubMed Score 33.58
PubTator Score 23.92

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (19)

PMID Text
26476214 ArgBP2 inhibits proliferation, migration, and invasion of gastric cancer cells.MORC2 down-regulates the ArgBP2 via histone methylation in gastric cancer cells.
26359233 SORBS2 transcription is activated by telomere position effect-over long distance upon telomere shortening in muscle cells from patients with facioscapulohumeral dystrophy
26214276 This study confirmed that SORBS2 as genetic modifiers of age at onset of Alzheimer disease.
25429109 ArgBP2 interaction with alpha-actinin and actin stress fibers inhibits cell migration
24475245 Tyrosine phosphorylation of ARGBP2 interferes with a SH3 mediated self-interaction, thereby controlling its panel of interacting partners and related functions.
24342996 Sarcoplasmic sorbin and SH3 domain-containing protein 2 is released from damaged cardiac tissue into the bloodstream upon lethal acute myocardial infarction.
24165198 SORBS2 and TLR3 induce premature senescence in primary human fibroblasts and keratinocytes.
22431180 In epithelial NMuMG cells, immunofluorescence analyses revealed localization of ArgBP2 at tight junctions and mutation analyses found a second SH3 domain to be important for ArgBP2 localization to the cell-cell contact sites.
22394629 the expression and localization of hArgBP2 in osteosarcoma MG-63 cells
21689717 A co-localization of SORBS2 and eEF1A was evidenced at level of plasma membrane, thus suggesting the involvement of eEF1A1 in novel key signal transduction complexes.
More...

AA Sequence

MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAP      1 - 70
HYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPA     71 - 140
AKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPR    141 - 210
SIFEYEPGKSSILQHERPASLYQSSIDRSLERPMSSASMASDFRKRRKSEPAVGPPRGLGDQSASRTSPG    211 - 280
RVDLPGSSTTLTKSFTSSSPSSPSRAKGGDDSKICPSLCSYSGLNGNPSSELDYCSTYRQHLDVPRDSPR    281 - 350
AISFKNGWQMARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPM    351 - 420
AWGSPYVPEVRSNGRSRIRHRSARNAPGFLKMYKKMHRINRKDLMNSEVICSVKSRILQYESEQQHKDLL    421 - 490
RAWSQCSTEEVPRDMVPTRISEFEKLIQKSKSMPNLGDDMLSPVTLEPPQNGLCPKRRFSIEYLLEEENQ    491 - 560
SGPPARGRRGCQSNALVPIHIEVTSDEQPRAHVEFSDSDQDGVVSDHSDYIHLEGSSFCSESDFDHFSFT    561 - 630
SSESFYGSSHHHHHHHHHHHRHLISSCKGRCPASYTRFTTMLKHERARHENTEEPRRQEMDPGLSKLAFL    631 - 700
VSPVPFRRKKNSAPKKQTEKAKCKASVFEALDSALKDICDQIKAEKKRGSLPDNSILHRLISELLPDVPE    701 - 770
RNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPR    771 - 840
SYSSTLTDMGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVG    841 - 910
IFPISYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLRKGDRVILLKRVDQNWYEGKI    911 - 980
PGTNRQGIFPVSYVEVVKKNTKGAEDYPDPPIPHSYSSDRIHSLSSNKPQRPVFTHENIQGGGEPFQALY    981 - 1050
NYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL                       1051 - 1100
//

Text Mined References (55)

PMID Year Title
26476214 2015 Microchidia protein 2, MORC2, downregulates the cytoskeleton adapter protein, ArgBP2, via histone methylation in gastric cancer cells.
26359233 2015 SORBS2 transcription is activated by telomere position effect-over long distance upon telomere shortening in muscle cells from patients with facioscapulohumeral dystrophy.
26214276 2015 Genetic Modifiers of Age at Onset in Carriers of the G206A Mutation in PSEN1 With Familial Alzheimer Disease Among Caribbean Hispanics.
25429109 2015 Arg kinase-binding protein 2 (ArgBP2) interaction with ?-actinin and actin stress fibers inhibits cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
24475245 2014 Oligomerization and phosphorylation dependent regulation of ArgBP2 adaptive capabilities and associated functions.
24342996 2013 Sorbin and SH3 domain-containing protein 2 is released from infarcted heart in the very early phase: proteomic analysis of cardiac tissues from patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165198 2013 SORBS2 and TLR3 induce premature senescence in primary human fibroblasts and keratinocytes.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...