Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.55
PubTator Score 14.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Migraine 83 0.0 2.9
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 4.8e-03
breast carcinoma 1.100 1.8e-02
lung cancer -1.300 3.2e-04
osteosarcoma 4.304 9.0e-09
ovarian cancer 1.500 1.6e-04
progressive supranuclear palsy -1.300 2.7e-02
psoriasis 1.700 9.8e-05
Waldenstrons macroglobulinemia 1.034 2.5e-02

Gene RIF (2)

AA Sequence

MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHTLDGKEYITPAQISKEMRDEL      1 - 70
HVRGGRVNIVDLQQVINVDLIHIENRIGDIIKSEKHVQLVLGQLIDENYLDRLAEEVNDKLQESGQVTIS     71 - 140
ELCKTYDLPGNFLTQALTQRLGRIISGHIDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLISKY    141 - 210
GFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDA    211 - 280
VSYIKKRYKTTQLLFLKAACVGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFS    281 - 350
KQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMKNNPVHLITEEDLKQISTLESVSTSKKDKKDE    351 - 420
RRRKATEGSGSMRGGGGGNAREYKIKKVKKKGRKDDDSDDESQSSHTGKKKPEISFMFQDEIEDFLRKHI    421 - 490
QDAPEEFISELAEYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKF    491 - 560
FADDTQAALTKHLLKSVCTDITNLIFNFLASDLMMAVDDPAAITSEIRKKILSKLSEETKVALTKLHNSL    561 - 630
NEKSIEDFISCLDSAAEACDIMVKRGDKKRERQILFQHRQALAEQLKVTEDPALILHLTSVLLFQFSTHS    631 - 700
MLHAPGRCVPQIIAFLNSKIPEDQHALLVKYQGLVVKQLVSQSKKTGQGDYPLNNELDKEQEDVASTTRK    701 - 770
ELQELSSSIKDLVLKSRKSSVTEE                                                  771 - 794
//

Text Mined References (26)

PMID Year Title