Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $278,534
PubMed Score 15.36
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.034 0.025
psoriasis 1.700 0.000
osteosarcoma 4.304 0.000
lung cancer -1.400 0.001
breast carcinoma 1.100 0.018
pilocytic astrocytoma 1.100 0.005
progressive supranuclear palsy -1.300 0.027
ovarian cancer 1.500 0.000

Synonym

Accession O94874 A0PJ53 B4DJ57 C0H5X5 Q8N765 Q9NTQ0
Symbols NLBP
RCAD
Maxer
KIAA0776

Gene

Gene RIF (2)

PMID Text
23839039 Overexpression of NLBP promotes the cell proliferation of lung adenocarcinoma through interacting with p120ctn.
20531390 Results identify a novel molecule named multiple alpha-helix protein located at ER (Maxer) downregulated by mutant ataxin-1 (Atx1) in Bergmann glia.

AA Sequence

MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHTLDGKEYITPAQISKEMRDEL      1 - 70
HVRGGRVNIVDLQQVINVDLIHIENRIGDIIKSEKHVQLVLGQLIDENYLDRLAEEVNDKLQESGQVTIS     71 - 140
ELCKTYDLPGNFLTQALTQRLGRIISGHIDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLISKY    141 - 210
GFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDA    211 - 280
VSYIKKRYKTTQLLFLKAACVGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFS    281 - 350
KQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMKNNPVHLITEEDLKQISTLESVSTSKKDKKDE    351 - 420
RRRKATEGSGSMRGGGGGNAREYKIKKVKKKGRKDDDSDDESQSSHTGKKKPEISFMFQDEIEDFLRKHI    421 - 490
QDAPEEFISELAEYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKF    491 - 560
FADDTQAALTKHLLKSVCTDITNLIFNFLASDLMMAVDDPAAITSEIRKKILSKLSEETKVALTKLHNSL    561 - 630
NEKSIEDFISCLDSAAEACDIMVKRGDKKRERQILFQHRQALAEQLKVTEDPALILHLTSVLLFQFSTHS    631 - 700
MLHAPGRCVPQIIAFLNSKIPEDQHALLVKYQGLVVKQLVSQSKKTGQGDYPLNNELDKEQEDVASTTRK    701 - 770
ELQELSSSIKDLVLKSRKSSVTEE                                                  771 - 794
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23839039 2013 Overexpression of a novel regulator of p120 catenin, NLBP, promotes lung adenocarcinoma proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20531390 2010 Suppression of the novel ER protein Maxer by mutant ataxin-1 in Bergman glia contributes to non-cell-autonomous toxicity.
More...