Property Summary

NCBI Gene PubMed Count 16
Grant Count 33
R01 Count 19
Funding $5,390,516.83
PubMed Score 34.26
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.400 0.001
osteosarcoma -3.238 0.000
tuberculosis and treatment for 3 months 1.500 0.000
interstitial cystitis 1.100 0.001
primary Sjogren syndrome 1.200 0.012
ulcerative colitis 1.500 0.000
ovarian cancer 1.500 0.001
pituitary cancer 1.100 0.000
Down syndrome 1.200 0.000

Gene RIF (2)

PMID Text
22902056 our study, for the first time, demonstrates FCHSD2 as a predictor of outcome for Acute myeloid leukemia patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQPPPRKVKVTQELKNIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGMQKLASQYLKRDWP      1 - 70
GVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVRSLKEQQLKRCVDQLTKIQTE     71 - 140
LQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLFQSRISLQKASVKLKARRSECNSKATHARND    141 - 210
YLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRD    211 - 280
YNLQLFLQENAVFHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLN    281 - 350
DLECHGAAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENE    351 - 420
RWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSYKASQPDELTI    421 - 490
EEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSNSTEAELVS    491 - 560
GSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSAS    561 - 630
ENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQAS    631 - 700
RHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV                                  701 - 740
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902056 2012 FCHSD2 predicts response to chemotherapy in acute myeloid leukemia patients.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...