Property Summary

NCBI Gene PubMed Count 16
PubMed Score 34.26
PubTator Score 4.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Crohn Disease 97
Juvenile arthritis 124
Disease Target Count P-value
osteosarcoma 7933 4.89607535099132E-10
tuberculosis and treatment for 3 months 327 4.28637950176921E-7
pituitary cancer 1972 4.19023028002139E-6
ulcerative colitis 2087 4.29435203298057E-5
Down syndrome 548 3.05187805236339E-4
psoriasis 6685 5.74968512356183E-4
interstitial cystitis 2299 0.00126262569065285
ovarian cancer 8492 0.00145099027996487
primary Sjogren syndrome 789 0.0117332134818744
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Genital herpes 10 3.926 2.0

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.400 0.001
osteosarcoma -3.238 0.000
tuberculosis and treatment for 3 months 1.500 0.000
interstitial cystitis 1.100 0.001
primary Sjogren syndrome 1.200 0.012
ulcerative colitis 1.500 0.000
ovarian cancer 1.500 0.001
pituitary cancer 1.100 0.000
Down syndrome 1.200 0.000

Synonym

Accession O94868 B4DNI3 Q7L8J9 Q8WVM2 Q96FV7 Q9UF77
Symbols NWK
SH3MD3

Gene

PDB

2DL5   2DL7  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
22902056 our study, for the first time, demonstrates FCHSD2 as a predictor of outcome for Acute myeloid leukemia patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQPPPRKVKVTQELKNIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGMQKLASQYLKRDWP      1 - 70
GVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVRSLKEQQLKRCVDQLTKIQTE     71 - 140
LQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLFQSRISLQKASVKLKARRSECNSKATHARND    141 - 210
YLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRD    211 - 280
YNLQLFLQENAVFHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLN    281 - 350
DLECHGAAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENE    351 - 420
RWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSYKASQPDELTI    421 - 490
EEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSNSTEAELVS    491 - 560
GSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSAS    561 - 630
ENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQAS    631 - 700
RHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV                                  701 - 740
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902056 2012 FCHSD2 predicts response to chemotherapy in acute myeloid leukemia patients.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...