Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.75
PubTator Score 0.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.000 0.000
osteosarcoma -2.508 0.000
medulloblastoma, large-cell -1.100 0.001
Pick disease -1.400 0.000
ovarian cancer -2.100 0.000

Synonym

Accession O94864 B4E3W3 Q6IB21 Q9H2T6
Symbols SPT7L
STAF65
SUPT7H
STAF65G
STAF65(gamma)

Gene

Gene RIF (3)

PMID Text
24852358 Our findings reveal a distinct role of STAF65gamma in nuclear import, transcriptional repression, and cell cycle regulation at high levels of expression, which is associated with poor clinical outcomes of lung adenocarcinoma.
18250150 optimal binding of STAGA to p53 involves interactions of STAGA subunits TAF9, GCN5, and ADA2b, respectively
15728473 A novel peptide ligand recognized by tumor-specific CD4+ T regulatory (Treg) cells is a dominant peptide derived from the mutated ARTC1 gene. ARTC1 peptide-activated CD4+ Treg cells suppress proliferation and IL-2 secretion of melanoma-reactive T cells.

AA Sequence

MNLQRYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLI      1 - 70
QHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSDPESDFYR     71 - 140
GKGEPVTELSWHSCRQLLYQAVATILAHAGFDCANESVLETLTDVAHEYCLKFTKLLRFAVDREARLGQT    141 - 210
PFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHSYMLQISKQLSEEYERIVNPEKATEDAKPVKIKEEPV    211 - 280
SDITFPVSEELEADLASGDQSLPMGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESE    281 - 350
EGNVSGHGVLGSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCKKRMRKI          351 - 414
//

Text Mined References (20)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24852358 2014 The transcriptional repression activity of STAF65? is facilitated by promoter tethering and nuclear import of class IIa histone deacetylases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18250150 2008 Multivalent binding of p53 to the STAGA complex mediates coactivator recruitment after UV damage.
17375202 2007 Identification of a small TAF complex and its role in the assembly of TAF-containing complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...