Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
R01 Count 1
Funding $141,310.51
PubMed Score 8.28
PubTator Score 7.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma 1.918 0.002
glioblastoma 1.300 0.000
active Crohn's disease 2.917 0.000
active ulcerative colitis 2.164 0.005
interstitial cystitis 1.400 0.001
pediatric high grade glioma 1.400 0.002
pilocytic astrocytoma 1.400 0.001
posterior fossa group A ependymoma 1.200 0.001
primary Sjogren syndrome 1.100 0.000
lung adenocarcinoma 1.297 0.000
invasive ductal carcinoma 1.100 0.014
ovarian cancer 1.600 0.001
pituitary cancer -2.600 0.000

Synonym

Accession O94855 Q8IYI7
Symbols CLCRP2

Gene

PDB

3EFO   3EG9   5KYU   5KYW   5KYX  

 GO Function (1)

Gene RIF (6)

PMID Text
25683121 three mutant SEC24D alleles in a rare autosomal-recessively inherited skeletal disorder characterized by pre- and postnatal bone fragility, skull ossification defects, craniofacial dysmorphism, and short stature
22404651 A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and export
20889976 Mutations in the carboxyl-terminal SEC24 binding motif of the serotonin transporter impair folding of the transporter
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
17210573 concentrative endoplasmic reticulum-export is contingent on a direct interaction of GAT1 with Sec24D.

AA Sequence

MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPGPPPPGPHQFG      1 - 70
QNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQLGSQLSAMQINSYGSGMAPPS     71 - 140
QGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNGPGASPLPLPMYRPDGLSGPPPPNAQYQPPP    141 - 210
LPGQTLGAGYPPQQANSGPQMAGAQLSYPGGFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGG    211 - 280
QVYATNTRGQIPPLVTTDCMIQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPL    281 - 350
YLVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG    351 - 420
SYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEETSAIRVGFITY    421 - 490
NKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLLDQIPDMFADSNENETVFAPV    491 - 560
IQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTNVYDSLAKDCVAHGC    561 - 630
SVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFR    631 - 700
ATDFFGGILMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCS    701 - 770
SQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK    771 - 840
VLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKSTMLPAAVRCSE    841 - 910
SRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQK    911 - 980
RPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN                      981 - 1032
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25683121 2015 Mutations in SEC24D, encoding a component of the COPII machinery, cause a syndromic form of osteogenesis imperfecta.
25416956 2014 A proteome-scale map of the human interactome network.
24405750 2014 CNIH4 interacts with newly synthesized GPCR and controls their export from the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22404651 2012 A triple arg motif mediates ?(2B)-adrenergic receptor interaction with Sec24C/D and export.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20889976 2010 Mutations in the carboxyl-terminal SEC24 binding motif of the serotonin transporter impair folding of the transporter.
More...