Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.62
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
adrenocortical carcinoma -1.157 7.0e-03
adult high grade glioma -3.100 1.5e-04
astrocytic glioma -2.000 3.6e-03
Astrocytoma, Pilocytic -3.700 1.8e-09
atypical teratoid / rhabdoid tumor -3.800 2.4e-12
Breast cancer 1.600 2.3e-10
breast carcinoma 1.100 4.5e-19
chronic kidney disease 1.100 4.5e-02
dermatomyositis 1.300 5.8e-03
Down syndrome -1.100 1.3e-03
ductal carcinoma in situ 2.000 2.0e-04
ependymoma -2.100 2.4e-03
gastric carcinoma 1.300 2.6e-02
glioblastoma -3.300 3.1e-11
group 3 medulloblastoma -2.400 5.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-02
invasive ductal carcinoma 1.251 1.5e-02
lung cancer -1.100 4.9e-03
lung carcinoma -1.300 1.4e-15
malignant mesothelioma -1.600 7.9e-06
medulloblastoma, large-cell -2.700 3.7e-05
nasopharyngeal carcinoma 1.400 3.0e-05
oligodendroglioma -2.200 2.2e-02
osteosarcoma -1.193 3.8e-02
ovarian cancer -1.900 1.6e-08
pancreatic cancer 1.100 4.5e-03
pancreatic carcinoma 1.100 4.5e-03
Pick disease -1.600 3.1e-02
primary pancreatic ductal adenocarcinoma 1.620 8.2e-03
primitive neuroectodermal tumor -3.500 7.9e-06
subependymal giant cell astrocytoma -3.256 1.1e-02
tuberculosis 1.200 8.4e-05

Gene RIF (5)

AA Sequence

MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTWKAKALWYKLD      1 - 70
KRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGL     71 - 140
GAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGWRAEFLPTDHS    141 - 210
LSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKE    211 - 280
ETGIDLENIVYYKDCTHYFVMTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQ    281 - 350
LPSLDFAMNHYGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD    351 - 420
TAWMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVRPHQVKHLYIT    421 - 490
KELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRP    491 - 560
ELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPVD    561 - 630
SWRKNYGENADLSLAKSSISNNYLNLTFPRKRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSN    631 - 700
QECGSSKEGGNQNKVKSMANQLLAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATP    701 - 770
SPSPPLKRQFPSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL    771 - 840
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPPSPPSRLPSPD    841 - 910
PAASSSPSTVDSASPARKEKKSPSGFHFHPSHLRTVHPQLTVGKVSSGIGAAAEVLVNLYMNDHRPKAQA    911 - 980
TSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFHRECFRCSICATTLRLAAYTFDCDEGKF    981 - 1050
YCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLH   1051 - 1120
PLLG                                                                     1121 - 1124
//

Text Mined References (20)

PMID Year Title