Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.11
PubTator Score 4.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 1.92675288427662E-21
oligodendroglioma 2849 2.7922554128172E-16
lung carcinoma 2844 1.39686065846982E-15
atypical teratoid / rhabdoid tumor 4369 8.20892285821726E-11
posterior fossa group B ependymoma 1530 5.04561358347657E-10
medulloblastoma 1524 1.71510486556576E-8
pilocytic astrocytoma 3086 1.5858282838758E-7
malignant mesothelioma 3163 1.975090322837E-7
medulloblastoma, large-cell 6234 9.76676802128587E-7
glioblastoma 5572 1.0146355067721E-6
pediatric high grade glioma 2712 1.349649984629E-6
nasopharyngeal carcinoma 1056 2.95592384067256E-5
primitive neuroectodermal tumor 3031 4.23405371278789E-5
tuberculosis 1563 8.35793383708906E-5
ovarian cancer 8492 1.7988808990498E-4
ductal carcinoma in situ 1745 2.04563285707463E-4
Down syndrome 548 0.00127769466385819
inflammatory breast cancer 404 0.00174452528393341
astrocytic glioma 2241 0.00187916828826088
pancreatic carcinoma 567 0.00447934324789638
lung cancer 4473 0.00486357681320548
pancreatic cancer 2300 0.00529035814930902
dermatomyositis 967 0.00578689501616393
invasive ductal carcinoma 2950 0.00650447258050007
adrenocortical carcinoma 1427 0.00699076805735362
primary pancreatic ductal adenocarcinoma 1271 0.00820642557207783
subependymal giant cell astrocytoma 2287 0.0109708451651283
gastric carcinoma 832 0.0257593511821168
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0267741570680038
Pick disease 1893 0.0305673229021074
osteosarcoma 7933 0.0378961887683514
chronic kidney disease 90 0.0446843342941263

Expression

  Differential Expression (32)

Synonym

Accession O94851 B4DGZ0 B7Z849 D3DQW5 G3XAC8 Q5KTR3 Q5KTR4 Q7Z3A8
Symbols MICAL-2
MICAL2PV1
MICAL2PV2

Gene

PDB

2E9K  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 GWAS Trait (2)

Pathway (1)

Gene RIF (4)

PMID Text
24440334 These data show that SRF/MRTF-A signaling is regulated by MICAL-2-dependent redox regulation of nuclear actin.
22331357 although MICAL1 is auto-inhibited by its C-terminal coiled-coil region, MICAL2 remains constitutively active and affects stress fibers, suggesting differential but complementary roles for MICAL1 and MICAL2 in actin microfilament regulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16675569 MICAL2-PV is likely to be involved in cancer progression of prostate cancer and could be a candidate as a novel molecular marker and/or target for treatment of prostate cancers.

AA Sequence

MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTWKAKALWYKLD      1 - 70
KRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGL     71 - 140
GAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGWRAEFLPTDHS    141 - 210
LSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKE    211 - 280
ETGIDLENIVYYKDCTHYFVMTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQ    281 - 350
LPSLDFAMNHYGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD    351 - 420
TAWMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVRPHQVKHLYIT    421 - 490
KELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRP    491 - 560
ELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPVD    561 - 630
SWRKNYGENADLSLAKSSISNNYLNLTFPRKRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSN    631 - 700
QECGSSKEGGNQNKVKSMANQLLAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATP    701 - 770
SPSPPLKRQFPSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL    771 - 840
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPPSPPSRLPSPD    841 - 910
PAASSSPSTVDSASPARKEKKSPSGFHFHPSHLRTVHPQLTVGKVSSGIGAAAEVLVNLYMNDHRPKAQA    911 - 980
TSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFHRECFRCSICATTLRLAAYTFDCDEGKF    981 - 1050
YCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLH   1051 - 1120
PLLG                                                                     1121 - 1124
//

Text Mined References (21)

PMID Year Title
26689989 2016 MICAL2 is a novel human cancer gene controlling mesenchymal to epithelial transition involved in cancer growth and invasion.
24440334 2014 Redox modification of nuclear actin by MICAL-2 regulates SRF signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23927065 2013 Actin stimulates reduction of the MICAL-2 monooxygenase domain.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22331357 2012 Differential regulation of actin microfilaments by human MICAL proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16675569 2006 Expression of novel molecules, MICAL2-PV (MICAL2 prostate cancer variants), increases with high Gleason score and prostate cancer progression.
More...