Property Summary

NCBI Gene PubMed Count 12
Grant Count 20
R01 Count 5
Funding $5,819,449.74
PubMed Score 136.16
PubTator Score 7.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.000

Gene RIF (6)

PMID Text
23667252 YAP binding to dendrin is a prosurvival mechanism in podocytes.
23143340 Increasing number of dendrin-positive nuclei in the glomeruli suggest acute glomerular injury in IgA nephropathy.
21606645 Relocation of dendrin to the podocyte nuclei is useful as a novel marker of podocyte injury in human glomerulopathy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18356187 In minimal change nephrotic syndrome, dendrin and ZO-1 are re-distributed within the podocytes. Whether this is a cause or a consequence of foot process effacement remains unclear.

AA Sequence

MLDGPLFSEGPDSPRELQDEESGSCLWVQKSKLLVIEVKTISCHYSRRAPSRQPMDFQASHWARGFQNRT      1 - 70
CGPRPGSPQPPPRRPWASRVLQEATNWRAGPLAEVRAREQEKRKAASQEREAKETERKRRKAGGARRSPP     71 - 140
GRPRPEPRNAPRVAQLAGLPAPLRPERLAPVGRAPRPSAQPQSDPGSAWAGPWGGRRPGPPSYEAHLLLR    141 - 210
GSAGTAPRRRWDRPPPYVAPPSYEGPHRTLGTKRGPGNSQVPTSSAPAATPARTDGGRTKKRLDPRIYRD    211 - 280
VLGAWGLRQGQGLLGGSPGCGAARARPEPGKGVVEKSLGLAAADLNSGSDSHPQAKATGSAGTEIAPAGS    281 - 350
ATAAPCAPHPAPRSRHHLKGSREGKEGEQIWFPKCWIPSPKKQPPRHSQTLPRPWAPGGTGWRESLGLGE    351 - 420
GAGPETLEGWKATRRAHTLPRSSQGLSRGEGVFVIDATCVVIRSQYVPTPRTQQVQLLPSGVTRVVGDSP    421 - 490
SQSKPGKEEGEGATVFPSPCQKRLSSSRLLHQPGGGRGGEAEGGRPGDSTLEERTFRILGLPAPEVNLRD    491 - 560
APTQPGSPEHQALGPAASGAQGRAEGSEVAVVQRRAGRGWARTPGPYAGALREAVSRIRRHTAPDSDTDE    561 - 630
AEELSVHSGSSDGSDTEAPGASWRNERTLPEVGNSSPEEDGKTAELSDSVGEILDVISQTEEVLFGVRDI    631 - 700
RGTQQGNRKRQ                                                               701 - 711
//

Text Mined References (14)

PMID Year Title
23667252 2013 Yes-associated protein (YAP) promotes cell survival by inhibiting proapoptotic dendrin signaling.
23143340 2013 Translocation of dendrin to the podocyte nucleus in acute glomerular injury in patients with IgA nephropathy.
21606645 2011 Dendrin location in podocytes is associated with disease progression in animal and human glomerulopathy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18356187 2008 Dendrin expression in glomerulogenesis and in human minimal change nephrotic syndrome.
17251388 2007 Expression and subcellular distribution of novel glomerulus-associated proteins dendrin, ehd3, sh2d4a, plekhh2, and 2310066E14Rik.
16751601 2006 CIN85 is localized at synapses and forms a complex with S-SCAM via dendrin.
16541075 2006 The finished DNA sequence of human chromosome 12.
16464232 2006 Postsynaptic recruitment of Dendrin depends on both dendritic mRNA transport and synaptic anchoring.
More...