Property Summary

NCBI Gene PubMed Count 18
PubMed Score 29.19
PubTator Score 4.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.100 2.0e-02
intraductal papillary-mucinous adenoma (... 1.300 8.3e-05
intraductal papillary-mucinous carcinoma... 1.200 5.5e-05
medulloblastoma, large-cell -1.100 1.4e-03
osteosarcoma 1.660 4.9e-08
ovarian cancer -1.400 1.2e-05
psoriasis 1.200 4.3e-07
spina bifida -1.013 4.2e-02

Synonym

Accession O94842 B4DPY8 B4DSM0 E7EV69
Symbols LCP1
MIG7
C14orf92
KIAA0737

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (7)

AA Sequence

MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFDDLADPSSSQD      1 - 70
GSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQ     71 - 140
LTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQK    141 - 210
APKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAK    211 - 280
KEYLKALAAYKDNQECQATVETVELDPAPPSQTPSPPPMATVDPASPAPASIEPPALSPSIVVNSTLSSY    281 - 350
VANQASSGAGGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVT    351 - 420
RSVLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKVRINLQQQPPP    421 - 490
LQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVS    491 - 560
GSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFVK             561 - 621
//

Text Mined References (27)

PMID Year Title