Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
Funding $123,850.5
PubMed Score 25.84
PubTator Score 4.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.200 0.000
osteosarcoma 1.660 0.000
medulloblastoma, large-cell -1.100 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.000
colon cancer -1.100 0.020
spina bifida -1.013 0.042
ovarian cancer -1.400 0.000

Gene RIF (7)

PMID Text
25631074 Cellular biotinylated TOX high mobility group box family member 4 (TOX4) is incorporated into HIV-1 Gag virus-like particles
24312278 a regulation of LEDGF interaction with chromatin by cellular partners of its PWWP domain could be involved in several processes linked to LEDGF tethering properties, such as lentiviral integration, DNA repair or transcriptional regulation
23127401 The formation of vasculogenic mimicry is inhibited by reducing the expression of Mig-7 in gastric cancer cells.
22496870 Compared with TOX4, expression of TOX1, TOX2 and TOX3 in normal lung was 25, 44, and 88%lower, respectively, supporting the premise that reduced promoter activity confers increased susceptibility to methylation during lung carcinogenesis.
21184731 interaction between TOX4 and platinated DNA
20516061 mammalian Wdr82 functions in a variety of cellular processes; PTW/PP1 phosphatase complex (PNUTS, Tox4, Wdr82, PP1) has a role in the regulation of chromatin structure during the transition from mitosis into interphase
19293638 the coordinated spatial and temporal regulation of LCP1 and PNUTS may be a novel mechanism to control the expression of genes that are critical for certain physiological and pathological processes.

AA Sequence

MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFDDLADPSSSQD      1 - 70
GSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQ     71 - 140
LTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQK    141 - 210
APKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAK    211 - 280
KEYLKALAAYKDNQECQATVETVELDPAPPSQTPSPPPMATVDPASPAPASIEPPALSPSIVVNSTLSSY    281 - 350
VANQASSGAGGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVT    351 - 420
RSVLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKVRINLQQQPPP    421 - 490
LQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVS    491 - 560
GSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFVK             561 - 621
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24312278 2013 TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23127401 2012 [Mig-7 enhances vasculogenic mimicry in gastric cancer cells].
22496870 2012 Differential epigenetic regulation of TOX subfamily high mobility group box genes in lung and breast cancers.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21184731 2011 TOX4 and its binding partners recognize DNA adducts generated by platinum anticancer drugs.
More...