Property Summary

NCBI Gene PubMed Count 28
Grant Count 12
R01 Count 9
Funding $566,051.13
PubMed Score 56.66
PubTator Score 8.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.099 0.002
ependymoma -1.200 0.043
osteosarcoma 1.445 0.002
sonic hedgehog group medulloblastoma 1.400 0.001
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 2.200 0.000
non-small cell lung cancer 1.131 0.000
lung cancer 1.200 0.000

Gene RIF (17)

PMID Text
25609812 Collectively, this study characterizes a novel protein complex, Tom70/Hsp90/IRF3/Bax, that is important for Sendai virus-induced apoptosis.
25022898 Tom70 acts as a molecular switch that orchestrates hypertrophic stresses and mitochondrial responses to determine pathological cardiac hypertrophy.
24149440 Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery.
23472196 PINK1 is imported into mitochondria by a unique pathway that is independent of the TOM core complex but crucially depends on the import receptor Tom70
22032846 The hepatitis C virus NS3/4A protein induced Tom70 expression.
21781956 used biophysical tools to study the interaction between the C-terminal domain of Hsp90 (C-Hsp90), which contains the EEVD motif that binds to TPR domains, and the cytosolic fragment of Tom70
21771790 a novel model in which Tom20 binds Tom70 to facilitate preprotein release from the chaperones by competition
21412788 This study revealed a novel finding, that is, human TOM70 is linked with the hepatitis C virus NS3 protein and the apoptotic response.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628368 Tom70 as a critical adaptor linking MAVS to TBK1/IRF3, revealing that mitochondrion is evolutionarily integrated with innate immunity.
More...

AA Sequence

MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARG      1 - 70
RGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEA     71 - 140
ISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDV    141 - 210
TAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSD    211 - 280
EDKDKEGEALEVKENSGYLKAKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKP    281 - 350
DLDKVISLKEANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA    351 - 420
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQ    421 - 490
QFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEIDNKCDFAYETMGTIEVQRGN    491 - 560
MEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKKYGLKPPTL                          561 - 608
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609812 2015 Tom70 mediates Sendai virus-induced apoptosis on mitochondria.
25022898 2014 Tom70 serves as a molecular switch to determine pathological cardiac hypertrophy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24149440 2013 The TOMM machinery is a molecular switch in PINK1 and PARK2/PARKIN-dependent mitochondrial clearance.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23911537 2013 Cytoplasmic ribosomal protein S3 (rpS3) plays a pivotal role in mitochondrial DNA damage surveillance.
23472196 2013 Tom70 is essential for PINK1 import into mitochondria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...