Property Summary

NCBI Gene PubMed Count 28
PubMed Score 61.00
PubTator Score 8.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.9e-05
ependymoma -1.200 4.3e-02
glioblastoma 1.100 1.7e-04
group 3 medulloblastoma 1.100 3.4e-02
lung cancer 1.200 4.2e-04
medulloblastoma, large-cell 2.200 1.7e-04
Multiple myeloma 1.099 1.9e-03
non-small cell lung cancer 1.131 3.3e-17
osteosarcoma 1.445 2.1e-03

Gene RIF (17)

AA Sequence

MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARG      1 - 70
RGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEA     71 - 140
ISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDV    141 - 210
TAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSD    211 - 280
EDKDKEGEALEVKENSGYLKAKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKP    281 - 350
DLDKVISLKEANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA    351 - 420
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQ    421 - 490
QFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEIDNKCDFAYETMGTIEVQRGN    491 - 560
MEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKKYGLKPPTL                          561 - 608
//

Text Mined References (44)

PMID Year Title