Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 5
Funding $1,997,661.01
PubMed Score 26.42
PubTator Score 6.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.600 0.002
hereditary spastic paraplegia -1.004 0.006
intraductal papillary-mucinous adenoma (... 1.600 0.001
psoriasis -1.300 0.000
Pick disease 1.500 0.000
ovarian cancer 1.400 0.004

Gene RIF (3)

PMID Text
25877867 E3 ligase listerin accesses nascent polypeptides stalled at the Sec61 translocon via a gap in the ribosome-translocon junction near the Sec61 lateral gate.
25578875 Results show that Listerin specificity for nascent chain-60S complexes depends on nuclear export mediator factor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPAIQGAEEIDSLVDSDFRMVLR      1 - 70
KLSKKDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRRVREATQQAFEKLILKVKKQL     71 - 140
APYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFPPSKQPEAIAFCKDEITSVLQDHLIKETPDTLSDPQ    141 - 210
TVPEEEREAKFYRVVTCSLLALKRLLCLLPDNELDSLEEKFKSLLSQNKFWKYGKHSVPQIRSAYFELVS    211 - 280
ALCQRIPQLMKEEASKVSPSVLLSIDDSDPIVCPALWEAVLYTLTTIEDCWLHVNAKKSVFPKLSTVIRE    281 - 350
GGRGLATVIYPYLLPFISKLPQSITNPKLDFFKNFLTSLVAGLSTERTKTSSLESSAVISAFFECLRFIM    351 - 420
QQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTAHNLENVLIHF    421 - 490
WERLSEICVAKISEPEADVESVLGVSNLLQVLQKPKSSLKSSKKKNGKVRFADEILESNKENEKCVSSEG    491 - 560
EKIEGWELTTEPSLTHNSSGLLSPLRKKPLEDLVCKLADISINYVNERKSEQHLRFLSTLLDSFSSSRVF    561 - 630
KMLLGDEKQSIVQAKPLEIAKLVQKNPAVQFLYQKLIGWLNEDQRKDFGFLVDILYSALRCCDNDMERKK    631 - 700
VLDDLTKVDLKWNSLLKIIEKACPSSDKHALVTPWLKGDILGEKLVNLADCLCNEDLESRVSSESHFSER    701 - 770
WTLLSLVLSQHVKNDYLIGDVYVERIIVRLHETLFKTKKLSEAESSDSSVSFICDVAYNYFSSAKGCLLM    771 - 840
PSSEDLLLTLFQLCAQSKEKTHLPDFLICKLKNTWLSGVNLLVHQTDSSYKESTFLHLSALWLKNQVQAS    841 - 910
SLDINSLQVLLSAVDDLLNTLLESEDSYLMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGRLSLNYE    911 - 980
CFKTDFKEQDIKTLPSHLCTSALLSKMVLIALRKETVLENNELEKIIAELLYSLQWCEELDNPPIFLIGF    981 - 1050
CEILQKMNITYDNLRVLGNTSGLLQLLFNRSREHGTLWSLIIAKLILSRSISSDEVKPHYKRKESFFPLT   1051 - 1120
EGNLHTIQSLCPFLSKEEKKEFSAQCIPALLGWTKKDLCSTNGGFGHLAIFNSCLQTKSIDDGELLHGIL   1121 - 1190
KIIISWKKEHEDIFLFSCNLSEASPEVLGVNIEIIRFLSLFLKYCSSPLAESEWDFIMCSMLAWLETTSE   1191 - 1260
NQALYSIPLVQLFACVSCDLACDLSAFFDSTTLDTIGNLPVNLISEWKEFFSQGIHSLLLPILVTVTGEN   1261 - 1330
KDVSETSFQNAMLKPMCETLTYISKEQLLSHKLPARLVADQKTNLPEYLQTLLNTLAPLLLFRARPVQIA   1331 - 1400
VYHMLYKLMPELPQYDQDNLKSYGDEEEEPALSPPAALMSLLSIQEDLLENVLGCIPVGQIVTIKPLSED   1401 - 1470
FCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLYHLFRLMPENPTYAETAVEVPNKDPKT   1471 - 1540
FFTEELQLSIRETTMLPYHIPHLACSVYHMTLKDLPAMVRLWWNSSEKRVFNIVDRFTSKYVSSVLSFQE   1541 - 1610
ISSVQTSTQLFNGMTVKARATTREVMATYTIEDIVIELIIQLPSNYPLGSIIVESGKRVGVAVQQWRNWM   1611 - 1680
LQLSTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWF   1681 - 1750
TSSNKSTCPLCRETFF                                                         1751 - 1766
//

Text Mined References (16)

PMID Year Title
25877867 2015 The ribosome quality control pathway can access nascent polypeptides stalled at the Sec61 translocon.
25578875 2015 Structure and assembly pathway of the ribosome quality control complex.
25132172 2014 Reconstitution of a minimal ribosome-associated ubiquitination pathway with purified factors.
23685075 2013 Listerin-dependent nascent protein ubiquitination relies on ribosome subunit dissociation.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21269460 2011 Initial characterization of the human central proteome.
20835226 2010 Role of a ribosome-associated E3 ubiquitin ligase in protein quality control.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19196968 2009 A mouse forward genetics screen identifies LISTERIN as an E3 ubiquitin ligase involved in neurodegeneration.
More...