Property Summary

NCBI Gene PubMed Count 6
PubMed Score 42.17
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 6.79156785402124E-9
malignant mesothelioma 3163 1.39276908880823E-7
medulloblastoma, large-cell 6234 1.772440744906E-7
ovarian cancer 8492 2.21512936470259E-7
atypical teratoid / rhabdoid tumor 4369 4.17697792226493E-7
breast carcinoma 1614 8.1699738725755E-7
osteosarcoma 7933 1.57697814810241E-6
pediatric high grade glioma 2712 3.36826146602932E-6
pilocytic astrocytoma 3086 2.54575688566733E-5
glioblastoma 5572 1.0878137551131E-4
cystic fibrosis 1670 3.28321433154668E-4
group 3 medulloblastoma 2254 4.51057149936595E-4
ulcerative colitis 2087 4.95623256569156E-4
primitive neuroectodermal tumor 3031 9.8189791870863E-4
interstitial cystitis 2299 0.00160987142781718
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00453573944007581
subependymal giant cell astrocytoma 2287 0.0128162542511067
fibroadenoma 557 0.0240652818857446
urothelial carcinoma 318 0.0324140775186484
ileal Crohn's disease 9 0.0425865597051845

Expression

  Differential Expression (20)

Synonym

Accession O94819 Q3L1I0
Symbols KLHDC7C

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Chicken OMA Inparanoid

AA Sequence

MEHAVAPCVLYPGTEPGAAGESESEGAASPAQTPCSLGASLCFSSGEESPPQSLASAAEGAATSPPSSGG      1 - 70
PRVVERQWEAGSAGAASPEELASPEERACPEEPAAPSPEPRVWLEDPASPEEPGEPAPVPPGFGAVYGEP     71 - 140
DLVLEVSGRRLRAHKAVLAARSDYFRARASRDVLRVQGVSLTALRLLLADAYSGRMAGVRPDNVAEVVAG    141 - 210
ARRLQLPGAAQRATDAVGPQLSLANCYEVLSAAKRQRLNELRDAAYCFMSDHYLEVLREPAVFGRLSGAE    211 - 280
RDLLLRRRLRAGRAHLLAAALGPAGERAGSRPQSPSGDADARGDAAVYCFHAAAGEWRELTRLPEGAPAR    281 - 350
GCGLCVLYNYLFVAGGVAPAGPDGRARPSDQVFCYNPATDSWSAVRPLRQARSQLRLLALDGHLYAVGGE    351 - 420
CLLSVERYDPRADRWAPVAPLPRGAFAVAHEATTCHGEIYVSGGSLFYRLLKYDPRRDEWQECPCSSSRE    421 - 490
RSADMVALDGFIYRFDLSGSRGEAQAAGPSGVSVSRYHCLAKQWSPCVAPLRLPGGPTGLQPFRCAALDG    491 - 560
AIYCVSRAGTWRFQPAREGEAGGDAGQGGGFEALGAPLDVRGVLIPFALSLPEKPPRGEQGAP           561 - 623
//

Text Mined References (8)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
14508709 2003 Slowed conduction and thin myelination of peripheral nerves associated with mutant rho Guanine-nucleotide exchange factor 10.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9314494 1997 High-resolution mapping and transcript identification at the progressive epilepsy with mental retardation locus on chromosome 8p.