Property Summary

NCBI Gene PubMed Count 6
PubMed Score 39.65
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.500 1.1e-03
Astrocytoma, Pilocytic -1.500 1.7e-05
atypical teratoid / rhabdoid tumor -3.000 4.2e-07
breast carcinoma -1.900 8.2e-07
cystic fibrosis 1.124 3.3e-04
fibroadenoma -1.200 2.4e-02
glioblastoma -1.600 3.2e-06
group 3 medulloblastoma -1.600 4.5e-04
ileal Crohn's disease -1.102 4.3e-02
interstitial cystitis -1.200 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.5e-03
lung adenocarcinoma -1.700 6.8e-09
malignant mesothelioma 2.400 1.4e-07
medulloblastoma, large-cell -2.200 1.8e-07
osteosarcoma -4.295 1.6e-06
ovarian cancer -1.900 2.2e-07
primitive neuroectodermal tumor -2.000 9.8e-04
subependymal giant cell astrocytoma -3.495 1.3e-02
ulcerative colitis -1.400 5.0e-04
urothelial carcinoma -1.400 3.2e-02

Synonym

Accession O94819 Q3L1I0
Symbols KLHDC7C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEHAVAPCVLYPGTEPGAAGESESEGAASPAQTPCSLGASLCFSSGEESPPQSLASAAEGAATSPPSSGG      1 - 70
PRVVERQWEAGSAGAASPEELASPEERACPEEPAAPSPEPRVWLEDPASPEEPGEPAPVPPGFGAVYGEP     71 - 140
DLVLEVSGRRLRAHKAVLAARSDYFRARASRDVLRVQGVSLTALRLLLADAYSGRMAGVRPDNVAEVVAG    141 - 210
ARRLQLPGAAQRATDAVGPQLSLANCYEVLSAAKRQRLNELRDAAYCFMSDHYLEVLREPAVFGRLSGAE    211 - 280
RDLLLRRRLRAGRAHLLAAALGPAGERAGSRPQSPSGDADARGDAAVYCFHAAAGEWRELTRLPEGAPAR    281 - 350
GCGLCVLYNYLFVAGGVAPAGPDGRARPSDQVFCYNPATDSWSAVRPLRQARSQLRLLALDGHLYAVGGE    351 - 420
CLLSVERYDPRADRWAPVAPLPRGAFAVAHEATTCHGEIYVSGGSLFYRLLKYDPRRDEWQECPCSSSRE    421 - 490
RSADMVALDGFIYRFDLSGSRGEAQAAGPSGVSVSRYHCLAKQWSPCVAPLRLPGGPTGLQPFRCAALDG    491 - 560
AIYCVSRAGTWRFQPAREGEAGGDAGQGGGFEALGAPLDVRGVLIPFALSLPEKPPRGEQGAP           561 - 623
//

Text Mined References (8)

PMID Year Title