Property Summary

NCBI Gene PubMed Count 32
Grant Count 19
R01 Count 15
Funding $1,337,625.62
PubMed Score 105.95
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.067 0.000
psoriasis -1.400 0.000
osteosarcoma 1.295 0.005
medulloblastoma, large-cell -1.100 0.001
juvenile dermatomyositis 1.194 0.000
lung cancer 1.600 0.048
ovarian cancer -2.300 0.000

 GO Function (1)

 MGI Term (1)

Gene RIF (15)

PMID Text
25629932 reveal a novel interconnection between autophagy, proteasome activity, and cell death mediated by the ubiquitin-like properties of ATG12
25439980 Analysis of hepatitis B virus capsid maturation steps revealed that Rab33B and Atg5/12/16L1 are required for proper particle assembly and/or stability.
24899049 The results revealed that the expression of Atg12 and LC3 II/LC3 I in the chondrocytes treated with TXC increased, compared to that in the untreated chondrocytes
24727585 Cav-1 competitively interacts with the ATG12-ATG5 system to suppress the formation and function of the latter in lung epithelial cells.
23307622 ATG12 is a novel determinant of breast cancer primary resistance to HER1/2-targeted therapeutics.
23202584 study to identify role of conjugation between ATG12 and ATG5 in LC3 lipidation; structural and mutational analyses of ATG12~ATG5-ATG16N revealed the conjugation generates a patch across ATG12 and ATG5 required for E3 activity
22170153 These data relate LC3B, ATG5 and ATG12 to mitochondrial quality control after oxidative damage, and to cellular longevity.
22152474 The Atg12 is as a positive mediator of mitochondrial apoptosis and show that Atg12 directly regulates the apoptotic pathway by binding and inactivating prosurvival Bcl-2 family members, including Bcl-2 and Mcl-1.
19901552 Calpain1 plays an important role in controlling the levels of autophagy in normal living cells by regulating the levels of a key signaling molecule, ATG12-ATG5 conjugate.
19197948 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKT      1 - 70
KKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG     71 - 140
//

Text Mined References (43)

PMID Year Title
26903539 2016 NBR1 enables autophagy-dependent focal adhesion turnover.
25629932 2014 Ubiquitination and proteasomal degradation of ATG12 regulates its proapoptotic activity.
25439980 2015 Rab33B and its autophagic Atg5/12/16L1 effector assist in hepatitis B virus naked capsid formation and release.
25416956 2014 A proteome-scale map of the human interactome network.
24899049 2014 Tougu Xiaotong capsule promotes chondrocyte autophagy by regulating the Atg12/LC3 conjugation systems.
24727585 2014 Interaction of caveolin-1 with ATG12-ATG5 system suppresses autophagy in lung epithelial cells.
23307622 2012 Autophagy-related gene 12 (ATG12) is a novel determinant of primary resistance to HER2-targeted therapies: utility of transcriptome analysis of the autophagy interactome to guide breast cancer treatment.
23202584 2013 Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
22342342 2012 A mammalian autophagosome maturation mechanism mediated by TECPR1 and the Atg12-Atg5 conjugate.
22170153 2012 Autophagy proteins LC3B, ATG5 and ATG12 participate in quality control after mitochondrial damage and influence lifespan.
More...