Property Summary

NCBI Gene PubMed Count 39
PubMed Score 122.11
PubTator Score 66.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 7.5e-11
juvenile dermatomyositis 1187 2.5e-08
psoriasis 6694 3.2e-04
Multiple myeloma 1332 3.5e-04
medulloblastoma, large-cell 6241 1.4e-03
osteosarcoma 7950 5.5e-03
lung cancer 4740 4.8e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.638 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
juvenile dermatomyositis 1.194 2.5e-08
lung cancer 1.600 4.8e-02
medulloblastoma, large-cell -1.100 1.4e-03
Multiple myeloma 2.067 3.5e-04
osteosarcoma 1.295 5.5e-03
ovarian cancer -2.300 7.5e-11
psoriasis -1.400 3.2e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (20)

AA Sequence

MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKT      1 - 70
KKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG     71 - 140
//

Text Mined References (50)

PMID Year Title