Property Summary

NCBI Gene PubMed Count 126
Grant Count 91
R01 Count 50
Funding $6,489,793.97
PubMed Score 97.74
PubTator Score 126.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94813 A0A0A6YYB8 B7ZLR5 O95710 Q17RU3 Q9Y5Q7 Slit-2
Symbols SLIL3
Slit-2

Gene

PANTHER Protein Class (1)

PDB

2V9T   2V70   2V9S   2WFH  

 GWAS Trait (1)

Gene RIF (108)

PMID Text
26713366 These results suggest that Slit2/Robo1 binding exerts an effect on cell migration, which is negatively regulated by Robo4, and Robo1 may function by interacting with CdGAP in HUVECs.
26542734 Overexpression of Slit2 induces its tumor suppressive effects in Breast cancer.
26400100 our findings indicated that Slit2/Robo1 axis possibly be regarded as a significant clinical parameter for predicting brain metastasis in breast cancer patients.
26282852 temporary up-regulation in remodeling vessel and down-regulation in remodeled vessel of polygonal-shape extravillous trophoblast cells occurred in tubal pregnancies
26264936 Significantly increased serum Slit2 levels and hepatic expression of Slit2 and Robo1 were observed in patients with liver fibrosis.
26026792 Mutations of the SLIT2-ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract
26021305 Slit2-exon 15 splicing variants have different roles in angiogenesis and HUVEC permeability
26002231 VEGFR2 activation was not affected by Slit2, but eNOS phosphorylation was diminished
25786906 Data indicate that SLIT2, miR-218-1, RET/PLAG1 and SLIT2/ROBO1 pathway involved in Hirschsprung's disease.
25605242 Slit2/Robo1 signaling promotes intestinal tumorigenesis through Src-mediated activation of the Wnt/beta-catenin pathway.
More...

AA Sequence

MRGVGWQMLSLSLGLVLAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRI      1 - 70
TKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQ     71 - 140
AIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNN    141 - 210
LYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCS    211 - 280
NNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSL    281 - 350
NSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR    351 - 420
AIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTE    421 - 490
DYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQL    491 - 560
RKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLS    561 - 630
SVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEI    631 - 700
PIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVP    701 - 770
KELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVV    771 - 840
PEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGP    841 - 910
VDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEED    911 - 980
GFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHD    981 - 1050
SKCILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLP   1051 - 1120
RTSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQIAT   1121 - 1190
DEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGN   1191 - 1260
PKIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQTGIL   1261 - 1330
PGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEG   1331 - 1400
HGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRDYYQKQQGYAA   1401 - 1470
CQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKCGCTRCVS              1471 - 1529
//

Text Mined References (128)

PMID Year Title
26713366 2016 Suppression of Slit2/Robo1 mediated HUVEC migration by Robo4.
26542734 2015 Function of Slit/Robo signaling in breast cancer.
26400100 2015 Low Expression of Slit2 and Robo1 is Associated with Poor Prognosis and Brain-specific Metastasis of Breast Cancer Patients.
26282852 2015 Role of Slit2/Robo1 in trophoblast invasion and vascular remodeling during ectopic tubal pregnancy.
26264936 2015 Activation of Slit2-Robo1 signaling promotes liver fibrosis.
26026792 2015 Mutations of the SLIT2-ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract.
26021305 2015 The differential roles of Slit2-exon 15 splicing variants in angiogenesis and HUVEC permeability.
26002231 2015 Slit2 modifies VEGF-induced angiogenic responses in rabbit skeletal muscle via reduced eNOS activity.
25786906 2015 SLIT2/ROBO1-miR-218-1-RET/PLAG1: a new disease pathway involved in Hirschsprung's disease.
25605242 2015 Slit2/Robo1 signaling promotes intestinal tumorigenesis through Src-mediated activation of the Wnt/?-catenin pathway.
More...