Property Summary

NCBI Gene PubMed Count 137
PubMed Score 103.97
PubTator Score 126.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.9
Melanoma 711 0.0 0.8
Skin cancer 469 0.0 0.8
Disease Target Count Z-score Confidence
Heart disease 306 0.0 2.7
Disease Target Count Z-score Confidence
Cancer 2499 3.744 1.9
Vesicoureteral reflux 32 3.226 1.6

Expression

  Differential Expression (27)

Disease log2 FC p
pancreatic cancer 1.200 1.4e-02
adrenocortical carcinoma -2.232 1.4e-02
adult high grade glioma -2.300 3.2e-03
astrocytic glioma -1.400 6.9e-03
Atopic dermatitis -1.100 3.7e-02
atypical teratoid/rhabdoid tumor 1.700 9.3e-03
breast carcinoma -1.300 8.4e-20
cystic fibrosis 1.051 1.6e-03
ependymoma 1.800 1.8e-05
fibroadenoma -1.200 3.3e-02
glioblastoma -1.900 4.1e-04
group 4 medulloblastoma -1.700 1.6e-02
interstitial cystitis -1.200 5.5e-03
intraductal papillary-mucinous adenoma (... -2.100 9.5e-04
intraductal papillary-mucinous carcinoma... -2.800 2.5e-04
intraductal papillary-mucinous neoplasm ... -2.100 2.0e-02
invasive ductal carcinoma -1.165 2.0e-02
lung adenocarcinoma -1.900 1.5e-14
lung cancer -2.600 2.0e-06
lung carcinoma -3.500 2.7e-26
non-small cell lung cancer -2.074 8.0e-16
oligodendroglioma -2.000 3.1e-02
osteosarcoma 1.676 1.8e-02
ovarian cancer -2.800 1.7e-10
pituitary cancer -2.600 1.2e-05
primary pancreatic ductal adenocarcinoma 1.061 3.8e-03
severe Alzheimer's disease -1.105 3.2e-02

Protein-protein Interaction (2)

Gene RIF (113)

AA Sequence

MRGVGWQMLSLSLGLVLAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRI      1 - 70
TKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQ     71 - 140
AIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNN    141 - 210
LYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCS    211 - 280
NNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSL    281 - 350
NSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR    351 - 420
AIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTE    421 - 490
DYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQL    491 - 560
RKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLS    561 - 630
SVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEI    631 - 700
PIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVP    701 - 770
KELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVV    771 - 840
PEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGP    841 - 910
VDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEED    911 - 980
GFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHD    981 - 1050
SKCILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLP   1051 - 1120
RTSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQIAT   1121 - 1190
DEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGN   1191 - 1260
PKIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQTGIL   1261 - 1330
PGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEG   1331 - 1400
HGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRDYYQKQQGYAA   1401 - 1470
CQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKCGCTRCVS              1471 - 1529
//

Text Mined References (139)

PMID Year Title