Property Summary

NCBI Gene PubMed Count 43
Grant Count 2
Funding $127,061.5
PubMed Score 86.52
PubTator Score 594.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94811 TPPP
Symbols p24
p25
TPPP1
TPPP/p25
p25alpha

Gene

 Grant Application (2)

Gene RIF (32)

PMID Text
26317805 Results reveal a link between p25 and BACE1 in Alzheimer disease (AD) brains and suggest that upregulated Cdk5 activation by p25 accelerates AD pathogenesis by enhancing BACE1 activity via phosphorylation.
26289831 the central folded domain of TPPP/p25 following binding to microtubules can drive s homotypic protein-protein interactions leading to bundled microtubules.
25445539 suggest that the zinc as a specific divalent cation could be involved in the fine-tuning of the physiological TPPP/p25 level counteracting both the enrichment and the lack of this protein leading to distinct central nervous system diseases
24655651 Epigenetic changes in TPPP, in combination with experiences of maltreatment, may confer risk for depression in children.
23727580 results suggest that ROCK regulates beta-catenin stability in cells via preventing TPPP1-mediated inhibition of HDAC6 activity, to reduce its acetylation and degradation via phosphorylation by CK1 and GSK3beta
23355470 dual Rock and Cdk phosphorylation of Tppp1 inhibits its regulation of the cell cycle to increase cell proliferation
23161404 GSK3 promotes the mitochondrial translocation of p53, enabling its interaction with Bcl2 to allow Bax oligomerization and the subsequent release of cytochrome C.
22328514 The RhoA-ROCK-LIMK2-TPPP pathway controls metaphase spindle-orientation; TPPP colocalizes with LIMK2 at the mitotic spindle.
22326478 The authors conclude that the modest structural changes that p25alpha undergoes can promote weak intermolecular contacts and that polyanions such as heparin play a central role in stabilizing these aggregates.
22083140 Wnt induces the phosphorylation of LRP6 which consequently access the catalytic pocket of GSK3 as pseudo-substrates, thus directly blocking its activity against beta-catenin.
More...

AA Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGRE      1 - 70
MHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREV     71 - 140
HRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGT    141 - 210
YDQKVQGGK                                                                 211 - 219
//

Text Mined References (48)

PMID Year Title
26317805 2015 Enhancement of BACE1 Activity by p25/Cdk5-Mediated Phosphorylation in Alzheimer's Disease.
26289831 2015 Self protein-protein interactions are involved in TPPP/p25 mediated microtubule bundling.
25445539 2015 Zinc-induced structural changes of the disordered tppp/p25 inhibits its degradation by the proteasome.
24655651 2014 Child abuse, depression, and methylation in genes involved with stress, neural plasticity, and brain circuitry.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23727580 2013 Tubulin polymerization promoting protein 1 (TPPP1) increases ?-catenin expression through inhibition of HDAC6 activity in U2OS osteosarcoma cells.
23355470 2013 Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation by Rho-associated coiled-coil kinase (rock) and cyclin-dependent kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell proliferation.
23161404 2013 Pharmacological inhibition of GSK3 attenuates DNA damage-induced apoptosis via reduction of p53 mitochondrial translocation and Bax oligomerization in neuroblastoma SH-SY5Y cells.
22328514 2012 TPPP acts downstream of RhoA-ROCK-LIMK2 to regulate astral microtubule organization and spindle orientation.
22326478 2012 Multiple roles of heparin in the aggregation of p25?.
More...