Property Summary

NCBI Gene PubMed Count 46
PubMed Score 92.48
PubTator Score 594.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.200 4.6e-02
adult high grade glioma -2.800 1.0e-06
astrocytic glioma -1.600 1.2e-02
Astrocytoma, Pilocytic -2.000 1.1e-08
atypical teratoid / rhabdoid tumor -2.800 5.2e-10
Breast cancer -2.200 3.0e-12
chronic rhinosinusitis -1.839 1.0e-02
cutaneous lupus erythematosus -1.800 4.4e-04
ductal carcinoma in situ -1.200 2.0e-03
ependymoma -1.800 3.5e-02
glioblastoma -2.100 7.2e-09
group 3 medulloblastoma -2.000 6.5e-04
intraductal papillary-mucinous adenoma (... 1.500 2.7e-03
lung cancer -1.800 7.9e-05
medulloblastoma, large-cell -3.100 1.1e-05
nasopharyngeal carcinoma -2.000 8.8e-08
non-small cell lung cancer -1.779 6.1e-14
oligodendroglioma -1.300 6.8e-12
primitive neuroectodermal tumor -1.700 9.6e-05
psoriasis -2.300 3.2e-04
subependymal giant cell astrocytoma -2.870 1.9e-03

Gene RIF (35)

AA Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGRE      1 - 70
MHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREV     71 - 140
HRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGT    141 - 210
YDQKVQGGK                                                                 211 - 219
//

Text Mined References (51)

PMID Year Title