Property Summary

Ligand Count 3
NCBI Gene PubMed Count 50
PubMed Score 13.19
PubTator Score 13.98

Knowledge Summary

Patent (8,429)

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical adenoma 1.060 1.5e-02
adult high grade glioma 1.600 8.1e-04
astrocytic glioma 1.300 5.4e-03
Astrocytoma, Pilocytic 1.600 4.8e-06
Breast cancer -1.600 3.4e-05
Down syndrome 1.100 1.6e-03
ependymoma 1.300 3.9e-03
glioblastoma 1.900 1.1e-09
group 3 medulloblastoma 1.100 1.8e-02
intraductal papillary-mucinous adenoma (... 1.200 2.3e-02
invasive ductal carcinoma -1.400 2.2e-02
lung carcinoma -1.600 6.0e-26
medulloblastoma, large-cell 1.600 1.6e-04
oligodendroglioma 1.200 4.8e-03
osteosarcoma 1.709 3.5e-04
ovarian cancer -1.800 1.1e-11
pituitary cancer -1.300 1.7e-02
primary Sjogren syndrome 1.100 1.1e-02
primitive neuroectodermal tumor 1.300 1.2e-05
Rheumatoid arthritis 1.500 3.6e-02
ulcerative colitis 1.300 5.3e-04

 GWAS Trait (1)

Gene RIF (35)

AA Sequence

MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTR      1 - 70
ESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSENILQLITSADEIHEGDLVEVV     71 - 140
LSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKR    141 - 210
RLSNVSLPGPGLSVPRPLQPEYVALPSEESHVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYT    211 - 280
RPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDIN    281 - 350
SDSSRGLDDTEEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE    351 - 420
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIIT    421 - 490
DTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASVCTSPGQGKDHKDLSTSISVS    491 - 560
NCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNL    561 - 630
HHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDL    631 - 700
KPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSL    701 - 770
SGTFPFNEDEDINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD    771 - 840
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP                        841 - 890
//

Text Mined References (59)

PMID Year Title