Property Summary

NCBI Gene PubMed Count 48
Grant Count 34
R01 Count 19
Funding $2,340,987.74
PubMed Score 40.13
PubTator Score 13.98

Knowledge Summary

Patent (8,429)

Expression

  Differential Expression (21)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (33)

PMID Text
26253275 Studies indicate that the loss of protein kinase D PKD1 is thought to promote invasion and metastasis, while PKD2 and upregulated PKD3 to be positive regulators of proliferation.
25802335 Loss of PKD2 enhanced KC proliferative potential while loss of PKD3 resulted in a progressive proliferation defect, loss of clonogenicity and diminished tissue regenerative ability.
25136641 for the first time, PKD3 is implicated in the transcription activation of latent HIV-1 provirus, and our results revealed a molecular mechanism of prostratin-induced HIV-1 transcription via PKCepsilon/PKD3/NF-kappaB signaling pathway.
24840177 Activation of PKD2 and further increase of PKD3 activity leads to additional phosphorylation and inhibition of endogenous phosphatase slingshot 1L.
24337579 PKD3 in TNBC cells provides a molecular connection between the Golgi and endolysosomal compartments to enhance proliferative mTORC1-S6K1 signaling.
24265314 PKD3 negatively regulates human airway epithelial barrier formation and integrity through down-regulation of claudin-1, which is a key component of tight junctions.
23393329 We have identified PKD2 and PKD3, especially PKD3, as novel cell growth regulators in HCC1806 triple-negative breast cancer cells
22983445 PKD antagonists inhibited differentiation and viability of human hematopoietic stem cells, and had less HDAC phosphorylation, confirming the need for PKD-HDAC signaling in erythropoiesis.
22893698 phosphorylation of GIT1 on serine 46 by PKD3 represents a molecular switch by which GIT1 localization, paxillin trafficking, and cellular protrusive activity are regulated.
20813663 PKD3 contributes to the proliferation and malignant growth of androgen-dependent prostate cancer cells in part by upregulating PSA expression.
More...

AA Sequence

MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTR      1 - 70
ESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSENILQLITSADEIHEGDLVEVV     71 - 140
LSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKR    141 - 210
RLSNVSLPGPGLSVPRPLQPEYVALPSEESHVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYT    211 - 280
RPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDIN    281 - 350
SDSSRGLDDTEEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE    351 - 420
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIIT    421 - 490
DTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASVCTSPGQGKDHKDLSTSISVS    491 - 560
NCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNL    561 - 630
HHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDL    631 - 700
KPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSL    701 - 770
SGTFPFNEDEDINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD    771 - 840
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP                        841 - 890
//

Text Mined References (57)

PMID Year Title
26253275 2015 Functional and therapeutic significance of protein kinase D enzymes in invasive breast cancer.
25802335 2015 Opposing growth regulatory roles of protein kinase D isoforms in human keratinocytes.
25136641 2014 Protein kinase D3 is essential for prostratin-activated transcription of integrated HIV-1 provirus promoter via NF-?B signaling pathway.
24840177 2014 Protein kinase d isoforms differentially modulate cofilin-driven directed cell migration.
24337579 2014 Elevated protein kinase D3 (PKD3) expression supports proliferation of triple-negative breast cancer cells and contributes to mTORC1-S6K1 pathway activation.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24265314 2013 Protein kinase D promotes airway epithelial barrier dysfunction and permeability through down-regulation of claudin-1.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23393329 2013 Protein kinases D2 and D3 are novel growth regulators in HCC1806 triple-negative breast cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...