Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.82
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.700 4.3e-04
astrocytic glioma -1.900 5.7e-03
Astrocytoma, Pilocytic -2.800 2.2e-08
atypical teratoid / rhabdoid tumor -3.500 6.2e-07
ependymoma -2.100 3.3e-02
glioblastoma -2.500 2.8e-07
group 4 medulloblastoma 1.500 4.3e-03
lung carcinoma 2.600 7.1e-54
Pick disease -1.700 6.7e-03
subependymal giant cell astrocytoma -3.034 5.3e-03

Gene RIF (6)

AA Sequence

MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTN      1 - 70
ALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQ     71 - 140
YNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEM    141 - 210
AIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMP    211 - 280
TVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGG    281 - 350
NTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQC    351 - 420
VERKCP                                                                    421 - 426
//

Text Mined References (26)

PMID Year Title