Property Summary

Ligand Count 17
NCBI Gene PubMed Count 22
PubMed Score 213.02
PubTator Score 84.96

Knowledge Summary

Patent (7,397)

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma 1.300 2.7e-03
interstitial cystitis 1.100 2.8e-03
intraductal papillary-mucinous adenoma (... 1.200 1.8e-03
intraductal papillary-mucinous carcinoma... 1.200 3.0e-03
lung carcinoma -1.200 1.1e-21
malignant mesothelioma 1.100 3.5e-06
medulloblastoma, large-cell -1.100 1.6e-02
non-small cell lung cancer -1.014 6.6e-15
osteosarcoma -1.571 3.8e-04
ovarian cancer 1.500 4.5e-06

Gene RIF (10)

AA Sequence

MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETK      1 - 70
SEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQ     71 - 140
MLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMK    141 - 210
DTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPE    211 - 280
TRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEEIEDGRDEGEEEDAVDAASTLENHTQNSSEVSPP    281 - 350
SLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDA    351 - 420
RIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSL    421 - 490
CTSESMDYGTNLSTDLSLNKEMGSLSIKDPKLYKKTLKRTRKFVVDGVEVSITTSKIISEDEKKDEEMRF    491 - 560
LRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQEINAKKKFFDTELENLERQQKQQVEKMEQD    561 - 630
HAVRRREEARRIRLEQDRDYTRFQEQLKLMKKEVKNEVEKLPRQQRKESMKQKMEEHTQKKQLLDRDFVA    631 - 700
KQKEDLELAMKRLTTDNRREICDKERECLMKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQR    701 - 770
HELLRKHEKEREQMQRYNQRMIEQLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHINGGGSAAEQREKI    771 - 840
KQFSQQEEKRQKSERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLKALDESHNQNL    841 - 910
KEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAECPNPSTPSKAAKFFPYSSADAS                911 - 968
//

Text Mined References (39)

PMID Year Title