Property Summary

NCBI Gene PubMed Count 20
Grant Count 74
R01 Count 37
Funding $18,450,897.18
PubMed Score 189.50
PubTator Score 84.96

Knowledge Summary

Patent (7,397)

Expression

  Differential Expression (10)

Synonym

Accession O94804 A6ND35 B2R8F5 B3KMY1 Q6NSK0 Q9UIW4
Symbols LOK
PRO2729

Gene

PDB

2J7T   4AOT   4BC6   4EQU   4USD   4USE   5AJQ  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (8)

PMID Text
23842845 STK10 functions as a tumor suppressor gene, and dysfunction of STK10 activity either through polymorphism or somatic mutations may confer anti-apoptotic effects contributing to carcinogenesis.
23209304 It was shown that lymphocyte-oriented and STE20 kinase were sufficient to restrict ezrin function to the apical domain. Both kinases were enriched in microvilli and locally activated there.
21905501 genetic polymorphism is associated with aspirin-intolerant asthma in a Korean population
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19255442 These studies identify a new ERM kinase of importance in lymphocytes and confirm the role of ezrin-radixin-moesin phosphorylation in regulating cell shape and motility.
12639966 Stk10 is a novel polo-like kinase kinase that cooperates with hSlk to regulate Plk1 function in human cells
11903060 Opposing roles of serine/threonine kinases MEKK1 and LOK in regulating the CD28 responsive element in T-cells

AA Sequence

MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETK      1 - 70
SEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQ     71 - 140
MLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMK    141 - 210
DTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPE    211 - 280
TRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEEIEDGRDEGEEEDAVDAASTLENHTQNSSEVSPP    281 - 350
SLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDA    351 - 420
RIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSL    421 - 490
CTSESMDYGTNLSTDLSLNKEMGSLSIKDPKLYKKTLKRTRKFVVDGVEVSITTSKIISEDEKKDEEMRF    491 - 560
LRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQEINAKKKFFDTELENLERQQKQQVEKMEQD    561 - 630
HAVRRREEARRIRLEQDRDYTRFQEQLKLMKKEVKNEVEKLPRQQRKESMKQKMEEHTQKKQLLDRDFVA    631 - 700
KQKEDLELAMKRLTTDNRREICDKERECLMKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQR    701 - 770
HELLRKHEKEREQMQRYNQRMIEQLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHINGGGSAAEQREKI    771 - 840
KQFSQQEEKRQKSERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLKALDESHNQNL    841 - 910
KEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAECPNPSTPSKAAKFFPYSSADAS                911 - 968
//

Text Mined References (37)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23842845 2013 STK10 missense mutations associated with anti-apoptotic function.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23209304 2012 Local phosphocycling mediated by LOK/SLK restricts ezrin function to the apical aspect of epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21905501 2011 Variations in the STK10 gene and possible associations with aspirin-intolerant asthma in a Korean population.
21606217 2011 Off-target serine/threonine kinase 10 inhibition by erlotinib enhances lymphocytic activity leading to severe skin disorders.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...