Property Summary

NCBI Gene PubMed Count 36
Grant Count 147
R01 Count 87
Funding $25,101,980.05
PubMed Score 171.44
PubTator Score 60.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.200 0.004
oligodendroglioma -1.100 0.002
psoriasis -1.500 0.000
medulloblastoma, large-cell 1.400 0.000
Atopic dermatitis -1.100 0.000
non-small cell lung cancer -1.943 0.000
intraductal papillary-mucinous adenoma (... -1.700 0.010
lung cancer -2.600 0.000
active Crohn's disease 2.766 0.007
active ulcerative colitis 3.365 0.030
interstitial cystitis -2.400 0.004
cystic fibrosis 1.200 0.016
adult high grade glioma 1.200 0.002
group 3 medulloblastoma -1.500 0.000
invasive ductal carcinoma -2.879 0.000
breast carcinoma -1.200 0.000
ductal carcinoma in situ -1.300 0.046
ovarian cancer -6.500 0.000
pituitary cancer -3.800 0.000

Synonym

Accession O94788 B3KY52 B4DZR2 F5H2Y9 H0YM00 Q2PJS6 Q8NHQ4 Q9UBR8 Q9UFY0 RALDH 2
Symbols RALDH2
RALDH2-T
RALDH(II)

Gene

PANTHER Protein Class (2)

PDB

4X2Q  

Protein-protein Interaction (7)

Gene RIF (26)

PMID Text
26634247 a critical role of ALDH1A2-RAR signaling in the pathogenesis of head and neck cancer.
26366059 High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients.
25793304 the distribution of RALDH1, RALDH2, and RALDH3 in the postnatal eye was determined.
25524880 ALDH1A2 is involved in the regulation of cancer stem cell properties in neuroblastoma.
25293959 Genetic association replicative and exploratory studies identify SNPs in ADA and MTR highly associated with isolated Neural tube defects (NTD)and SNP in ARID1A and ALDH1A2 associated with NTDs in whites and African Americans respectively.
24884875 At the transcript level, the cisplatin + DEAB-resistant cells showed upregulated mRNA expression levels for ALDH1A2, ALDH1A3 isozymes and CD44 indicating the involvement of these markers in conferring chemoresistance
24728293 Severe osteoarthritis of the hand associates with common variants within the ALDH1A2 gene and with rare variants at 1p31.
24524833 These findings suggest that ALDH1A2 is the enzyme involved in retinoic acid biosynthesis in human germ cells.
24236815 DNA methylation at multiple CpG sites is associated with loss of control over alcohol drinking.
23833249 all three proteins (RDH10, RALDH2, and CRABP2) appeared to be required for ATRA production induced by activation of PPARgamma
More...

AA Sequence

MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQ      1 - 70
EADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDL     71 - 140
QGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIK    141 - 210
PAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNL    211 - 280
KRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVG    281 - 350
SPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG    351 - 420
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSG    421 - 490
NGREMGEFGLREYSEVKTVTVKIPQKNS                                              491 - 518
//

Publication (40)

PMID Year Title
26634247 2015 Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma.
26366059 2015 Distinct prognostic values and potential drug targets of ALDH1 isoenzymes in non-small-cell lung cancer.
25793304 2015 Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye.
25524880 2015 Involvement of aldehyde dehydrogenase 1A2 in the regulation of cancer stem cell properties in neuroblastoma.
25293959 2014 Replication and exploratory analysis of 24 candidate risk polymorphisms for neural tube defects.
24884875 2014 Cisplatin-resistant cells in malignant pleural mesothelioma cell lines show ALDH(high)CD44(+) phenotype and sphere-forming capacity.
24728293 2014 Severe osteoarthritis of the hand associates with common variants within the ALDH1A2 gene and with rare variants at 1p31.
24524833 2014 Levels of the retinoic acid synthesizing enzyme aldehyde dehydrogenase-1A2 are lower in testicular tissue from men with infertility.
24236815 2014 Methylation of a CpG site near the ALDH1A2 gene is associated with loss of control over drinking and related phenotypes.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
More...