Property Summary

NCBI Gene PubMed Count 39
PubMed Score 175.33
PubTator Score 60.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 2.766 6.7e-03
active ulcerative colitis 3.365 3.0e-02
adult high grade glioma 1.200 1.6e-03
Atopic dermatitis -1.100 2.6e-04
breast carcinoma -1.200 2.4e-21
cystic fibrosis 1.200 1.6e-02
ductal carcinoma in situ -1.300 4.6e-02
ependymoma -1.200 4.3e-03
group 3 medulloblastoma -1.500 2.3e-04
interstitial cystitis -1.800 1.0e-02
intraductal papillary-mucinous adenoma (... -1.700 9.7e-03
invasive ductal carcinoma -2.879 8.2e-05
lung cancer -2.500 3.7e-03
medulloblastoma, large-cell 1.400 3.3e-05
non-small cell lung cancer -1.943 1.7e-12
oligodendroglioma -1.100 2.0e-03
ovarian cancer -1.100 4.1e-13
pituitary cancer -3.800 5.6e-06
psoriasis -1.400 1.9e-03

Gene RIF (29)

AA Sequence

MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQ      1 - 70
EADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDL     71 - 140
QGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIK    141 - 210
PAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNL    211 - 280
KRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVG    281 - 350
SPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG    351 - 420
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSG    421 - 490
NGREMGEFGLREYSEVKTVTVKIPQKNS                                              491 - 518
//

Text Mined References (43)

PMID Year Title