Property Summary

NCBI Gene PubMed Count 34
Grant Count 48
R01 Count 42
Funding $4,861,696.52
PubMed Score 68.51
PubTator Score 60.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.731 0.004
malignant mesothelioma 1.700 0.000
psoriasis 1.200 0.000
osteosarcoma 1.883 0.000
group 3 medulloblastoma 1.600 0.002
atypical teratoid/rhabdoid tumor 1.400 0.000
glioblastoma 1.200 0.003
medulloblastoma, large-cell 1.600 0.001
primitive neuroectodermal tumor 1.100 0.006
juvenile dermatomyositis 1.156 0.000
Amyotrophic Lateral Sclerosis 1.301 0.000
acute quadriplegic myopathy 1.299 0.000
lung cancer 1.100 0.008
Breast cancer 3.400 0.037
pediatric high grade glioma 1.200 0.001
Pick disease 1.100 0.000
ovarian cancer 2.600 0.000
dermatomyositis 1.300 0.004

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
504865 confirmatory 358 / 1595 / 6637 Inhibitors of USP1/UAF1: Pilot qHTS
504878 summary 0 / 0 / 0 Inhibitors of USP1/UAF1: Summary
540327 confirmatory 25 / 21 / 4 Inhibitors of USP1/UAF1: Hit Validation in Primary Assay
624346 other 19 / 1 / 5 Inhibitors of USP1/UAF1: Hit Validation in USP1 Diubiquiting Gel Assay
651605 confirmatory 109 / 30 / 8 Inhibitors of USP1/UAF1: SAR in Primary Assay
651621 other 1 / 0 / 0 Inhibitors of USP1/UAF1: SAR in USP1/UAF1 diubiquitin SDS-PAGE gel assay
743255 confirmatory 906 / 19243 / 372568 Inhibitors of USP1/UAF1: Primary Screen

Gene RIF (17)

PMID Text
26825230 Translational regulation of the mRNA encoding USP1 is involved in the DNA damage response as a determinant of cisplatin resistance.
26758085 analysis of the function and regulation of the USP1-UAF1 complex
26117423 No correlation was observed between the protein level of ubiquitin-specific protease 1 (USP1) and ubiquitinated PCNA in BAF180 expressing cells
26032834 Ubiquitination-specific proteases 1 (USP1)-mediated protein stabilization promotes glioblastoma (GBM) stem-like cells maintenance and treatment resistance, thereby providing a rationale for USP1 inhibition as a potential therapeutic approach against GBM.
26002196 USP1, p21 and Spartan are translesion DNA synthesis regulators. (Review)
25744535 USP1 phosphorylation at S313 is not critical for PCNA deubiquitination, neither for binding to UAF1 in a cellular environment.
24850727 Coimmunoprecipitation experiments indicated that human papillomavirus type 31 E1 assembles into a ternary complex with UAF1 and any one of these three USPs: USP1, USP12 and USP46.
23116119 Our findings revealed an intriguing mechanism of regulating USP1 activity that combines phosphorylation of a key serine residue in USP1 and the specific interaction of USP1 with a WD40-repeat protein UAF1
22701671 USP1 and UAF1 form a complex in the cytoplasm that subsequently translocates to the nucleus through import mediated by USP1 nuclear localization signals.
22426999 data identified a novel USP1-PHLPP1-Akt signaling axis, and decreased USP1 level in lung cancer cells may play an important role in lung cancer progress.
More...

AA Sequence

MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPIN      1 - 70
CEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSL     71 - 140
ASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGN    141 - 210
IQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNM    211 - 280
KKKVKLSKEHQSLEENQRQTRSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPS    281 - 350
ILSKFCSLGKITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ    351 - 420
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAIS    421 - 490
QFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPL    491 - 560
KLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEE    561 - 630
EARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRN    631 - 700
SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPS    701 - 770
TSPTSTPYLLFYKKL                                                           771 - 785
//

Publication (42)

PMID Year Title
26825230 2016 Translational regulation of the mRNA encoding the ubiquitin peptidase USP1 involved in the DNA damage response as a determinant of Cisplatin resistance.
26758085 2016 Mutations in the 'Fingers' subdomain of the deubiquitinase USP1 modulate its function and activity.
26388029 2015 Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
26117423 2015 The BAH domain of BAF180 is required for PCNA ubiquitination.
26032834 2016 USP1 targeting impedes GBM growth by inhibiting stem cell maintenance and radioresistance.
26002196 2015 The identification of translesion DNA synthesis regulators: Inhibitors in the spotlight.
25744535 2015 Structure-function analysis of USP1: insights into the role of Ser313 phosphorylation site and the effect of cancer-associated mutations on autocleavage.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24850727 2014 E1-mediated recruitment of a UAF1-USP deubiquitinase complex facilitates human papillomavirus DNA replication.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
More...