Property Summary

Ligand Count 2
NCBI Gene PubMed Count 41
PubMed Score 73.31
PubTator Score 60.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.119 7.1e-05
Amyotrophic lateral sclerosis 1.301 2.6e-06
atypical teratoid / rhabdoid tumor 1.300 1.9e-03
Breast cancer 3.400 3.7e-02
dermatomyositis 1.300 4.3e-03
glioblastoma 1.200 2.8e-03
group 3 medulloblastoma 1.600 1.6e-03
juvenile dermatomyositis 1.156 6.5e-09
lung cancer 1.100 8.4e-03
malignant mesothelioma 1.700 2.4e-05
medulloblastoma, large-cell 1.600 6.3e-04
osteosarcoma 1.883 1.3e-04
ovarian cancer -1.100 7.9e-03
pediatric high grade glioma 1.200 5.3e-04
Pick disease 1.100 1.4e-04
primitive neuroectodermal tumor 1.100 6.1e-03
psoriasis 1.100 4.7e-05
Waldenstrons macroglobulinemia 1.731 3.6e-03

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPIN      1 - 70
CEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSL     71 - 140
ASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGN    141 - 210
IQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNM    211 - 280
KKKVKLSKEHQSLEENQRQTRSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPS    281 - 350
ILSKFCSLGKITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ    351 - 420
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAIS    421 - 490
QFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPL    491 - 560
KLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEE    561 - 630
EARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRN    631 - 700
SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPS    701 - 770
TSPTSTPYLLFYKKL                                                           771 - 785
//

Text Mined References (47)

PMID Year Title