Property Summary

NCBI Gene PubMed Count 61
PubMed Score 116.26
PubTator Score 72.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

AA Sequence

MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPAL      1 - 70
AHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNA     71 - 140
SGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMN    141 - 210
PARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR                       211 - 261
//

Text Mined References (62)

PMID Year Title