Property Summary

NCBI Gene PubMed Count 55
Grant Count 11
R01 Count 5
Funding $477,459.5
PubMed Score 112.27
PubTator Score 72.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
26779650 AQP6 and AQP8 had different expression degrees in epithelial ovarian tissues, which suggests that AQP6 and AQP8 may play certain roles in epithelial ovarian tumors.
25550802 EGF induces AQP8 expression and cell migration in Eca-109 cells via the EGFR/Erk1/2 signal transduction pathway.
25120769 increased AQP8, Erk1/2 and phosphorylated-Erk1/2 expression may play a role in transformation of cervical intraepithelila neoplasia into cervical cancer, and in early invasion and lymphatic metastasis of cervical cancer
24440277 the results here reported indicate that AQP8 is able to modulate H2O2 transport through the plasma membrane affecting redox signalling linked to leukaemia cell proliferation
24415197 mtAQP8 knockdown induces necrotic cell death in human neoplastic hepatic cells, a finding that might be relevant to therapeutic strategies against hepatoma cells.
24055034 The expression levels and immunoreactive score of AQP8 protein and mRNA increased in low-grade astrocytomas, and further increased in high-grade astrocytomas, especially in glioblastoma.
23953589 AQP8 has a role in the pathogenesis of PCOS.
23679281 High Aquaporin 8 expression is associated with invasion of cervical cancer.
23595390 AQP8 and its relationship with miRNAs may be involved in the pathogenesis of Ulcerative colitis (UC).
22901156 AQP8 expression significantly increased in advanced stage of cervical cancer, deeper infiltration, metastatic lymph nodes and larger tumor volume.
More...

AA Sequence

MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPAL      1 - 70
AHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNA     71 - 140
SGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMN    141 - 210
PARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR                       211 - 261
//

Publication (56)

PMID Year Title
26779650 2016 Expression of AQP6 and AQP8 in epithelial ovarian tumor.
25550802 2014 Aquaporin-8 mediates human esophageal cancer Eca-109 cell migration via the EGFR-Erk1/2 pathway.
25120769 2014 Expression of aquaporin 8 and phosphorylation of Erk1/2 in cervical epithelial carcinogenesis: correlation with clinicopathological parameters.
24440277 2014 Specific aquaporins facilitate Nox-produced hydrogen peroxide transport through plasma membrane in leukaemia cells.
24415197 2014 Evidence for necrosis, but not apoptosis, in human hepatoma cells with knockdown of mitochondrial aquaporin-8.
24055034 2013 Expression of aquaporin8 in human astrocytomas: correlation with pathologic grade.
23953589 2013 Association of AQP8 in women with PCOS.
23679281 2013 Increased migration and local invasion potential of SiHa cervical cancer cells expressing Aquaporin 8.
23595390 2013 Aquaporin 8 expression is reduced and regulated by microRNAs in patients with ulcerative colitis.
22901156 2012 Significance and expression of aquaporin 1, 3, 8 in cervical carcinoma in Xinjiang Uygur women of China.
More...