Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.82
PubTator Score 8.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.300 0.001

Synonym

Accession O94777 Q5XKK9 Q6FGH3
Symbols CDG1U

Gene

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (1)

PMID Text
23109149 We describe a new congenital disorders of glycosylation, due to a deficiency of DPM2

AA Sequence

MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFIS      1 - 70
YVMLKTKRVTKKAQ                                                             71 - 84
//

Publication (12)

PMID Year Title
23109149 2012 DPM2-CDG: a muscular dystrophy-dystroglycanopathy syndrome with severe epilepsy.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
16280320 2006 DPM1, the catalytic subunit of dolichol-phosphate mannose synthase, is tethered to and stabilized on the endoplasmic reticulum membrane by DPM3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.
10944123 2000 Initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-P and is regulated by DPM2.
10835346 2000 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3.
More...