Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.57
PubTator Score 8.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 9.5e-06
psoriasis 1.300 1.2e-03

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFIS      1 - 70
YVMLKTKRVTKKAQ                                                             71 - 84
//

Text Mined References (12)

PMID Year Title