Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.82
PubTator Score 8.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.300 0.001

Synonym

Accession O94777 Q5XKK9 Q6FGH3
Symbols CDG1U

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
23109149 We describe a new congenital disorders of glycosylation, due to a deficiency of DPM2

AA Sequence

MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFIS      1 - 70
YVMLKTKRVTKKAQ                                                             71 - 84
//

Text Mined References (12)

PMID Year Title
23109149 2012 DPM2-CDG: a muscular dystrophy-dystroglycanopathy syndrome with severe epilepsy.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
16280320 2006 DPM1, the catalytic subunit of dolichol-phosphate mannose synthase, is tethered to and stabilized on the endoplasmic reticulum membrane by DPM3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.
10944123 2000 Initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-P and is regulated by DPM2.
10835346 2000 Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3.
More...