Property Summary

NCBI Gene PubMed Count 61
PubMed Score 32.28
PubTator Score 397.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.9e-06
diabetes mellitus 1728 3.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.163 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 3.0e-03
osteosarcoma 1.333 2.9e-06

Gene RIF (26)

AA Sequence

MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEES      1 - 70
KQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTL     71 - 140
LADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCS    141 - 210
SSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEAL    211 - 280
EKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV    281 - 350
GSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP    351 - 420
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANA    421 - 490
IKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKR    491 - 560
AYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAAR    561 - 630
RPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED                                    631 - 668
//

Text Mined References (77)

PMID Year Title