Property Summary

NCBI Gene PubMed Count 52
Grant Count 18
R01 Count 18
Funding $1,102,672.54
PubMed Score 31.53
PubTator Score 397.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.333 0.000
diabetes mellitus -1.100 0.003

Protein-protein Interaction (9)

Gene RIF (23)

PMID Text
26722504 These results indicated there might be a tight correlation among MTA2, Ki-67 and hepatocellular carcinoma prognosis
26261611 MTA2 is a crucial biomarker that is closely related with prognosis of colorectal carcinoma and also a potential molecular target for evaluating the prognosis and treatment of CRC.
25969565 MTA-2 protein may facilitate the invasive potential of non-small-cell lung cancer cells through the inhibition of the cell adhesion molecule Ep-CAM and E-cadherin, suggesting that it might be a potential therapeutic target in NSCLC.
25929737 MTA2 overexpression enhances colony formation and tumor growth of gastric cancer cells, but not plays important role in cancer cell migration and metastasis. IL-11 is one of the downstream effectors of MTA2 in regulating gastric cancer cells growth
25394532 MTA2 acts as a central hub for cytoskeletal organization and transcription and provides a link between nuclear and cytoskeletal organization.
25081667 MTA2 depletion could significantly inhibit human breast cancer cell growth and metastasis, implying that MTA2 might be involved in the progression of breast cancer.
25048531 High MTA2 protein and mRNA expression is associated with glioma.
24969834 Study demonstrates that hBD-3 inhibits the progression of colon cancer in a paracrine fashion through downregulation of MTA2 expression.
24830473 Mta2 and Tipin cooperate to maintain replication fork integrity, especially on regions that are intrinsically difficult to duplicate.
24468085 results reveal a novel post-translational regulation of MTA2 by the way of p300-dependent acetylation, which is important for tumor cells growth and migration and provides a potential target for clinical cancer research
More...

AA Sequence

MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEES      1 - 70
KQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTL     71 - 140
LADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCS    141 - 210
SSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEAL    211 - 280
EKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV    281 - 350
GSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP    351 - 420
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANA    421 - 490
IKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKR    491 - 560
AYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAAR    561 - 630
RPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED                                    631 - 668
//

Publication (67)

PMID Year Title
26869315 2016 Structure, expression and functions of MTA genes.
26722504 2015 Expression of MTA2 and Ki-67 in hepatocellular carcinoma and their correlation with prognosis.
26261611 2015 Prognostic correlation between MTA2 expression level and colorectal cancer.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25969565 2015 Metastasis-associated protein 2 (MTA2) promotes the metastasis of non-small-cell lung cancer through the inhibition of the cell adhesion molecule Ep-CAM and E-cadherin.
25929737 2015 MTA2 enhances colony formation and tumor growth of gastric cancer cells through IL-11.
25394532 2014 Role of MTA2 in human cancer.
25315816 2014 Identification and characterization of metastasis-associated gene/protein 1 (MTA1).
25081667 2014 Short-hairpin RNA-mediated MTA2 silencing inhibits human breast cancer cell line MDA-MB231 proliferation and metastasis.
25048531 2014 Metastasis tumor-associated protein-2 knockdown suppresses the proliferation and invasion of human glioma cells in vitro and in vivo.
More...