Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.20
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical adenoma -1.196 5.7e-03
adult high grade glioma 2.300 6.3e-04
astrocytoma 1.400 1.2e-07
Astrocytoma, Pilocytic 1.900 3.0e-04
Atopic dermatitis -1.800 6.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.862 2.3e-03
breast carcinoma -1.700 5.2e-04
cystic fibrosis -1.190 5.8e-03
Duchenne muscular dystrophy 1.457 9.8e-07
ductal carcinoma in situ -2.600 3.5e-04
ependymoma 3.500 3.8e-02
fibroadenoma -2.400 2.6e-03
glioblastoma 1.600 2.7e-03
intraductal papillary-mucinous adenoma (... -2.900 9.0e-05
intraductal papillary-mucinous carcinoma... -3.100 4.9e-04
intraductal papillary-mucinous neoplasm ... -2.500 7.1e-03
invasive ductal carcinoma -3.100 7.0e-05
lung adenocarcinoma -1.300 6.2e-10
lung carcinoma -1.100 5.3e-06
malignant mesothelioma -3.000 1.3e-06
non-small cell lung cancer -1.820 4.7e-17
ovarian cancer -5.100 1.5e-11
Pick disease 1.600 1.0e-02
psoriasis -1.100 1.8e-03
sonic hedgehog group medulloblastoma 1.400 1.5e-02

AA Sequence

MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLPIV      1 - 70
NFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHP     71 - 140
QRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDRIVRKEA    141 - 210
LQSEEDEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGE    211 - 280
EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLEL    281 - 350
TGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELK    351 - 420
VNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEEL    421 - 490
YLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLH    491 - 560
LVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEM    561 - 630
KALHFLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK     631 - 699
//

Text Mined References (12)

PMID Year Title